BLASTX 2.0.8 [Jan-05-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 14VII56R (693 letters) Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR 368,476 sequences; 112,640,273 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value gi|1353073|sp|P34316|YKT5_CAEEL HYPOTHETICAL 41.7 KD PROTEIN C07... 34 1.1
>gi|1353073|sp|P34316|YKT5_CAEEL HYPOTHETICAL 41.7 KD PROTEIN C07A9.5 IN CHROMOSOME III >gi|482082|pir||S40709 actin-binding protein homolog C07A9.5 - Caenorhabditis elegans >gi|3873985|emb|CAA82343| (Z29094) Similarity to spectrin C terminal domain and actinin; cDNA EST EMBL:D27532 comes from this gene; cDNA EST EMBL:C10914 comes from this gene; cDNA EST EMBL:C12837 comes from this gene; cDNA EST EMBL:D34791 comes from thi... Length = 358 Score = 34.0 bits (76), Expect = 1.1 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 5/82 (6%) Query: 10 DKRYIIEQFFSKFTFQSIVKEINKYLKDRKSGLNLFNQL-----REYLTNKFREEFKISN 174 + RYI + FS T ++ E+ + L+ S L Q +T K EFK++ Sbjct: 179 ESRYIFDNTFSSATPHGVLVEMCQCLELMSSMLRSVEQSIADRNHNGVTEKQLHEFKLA- 237 Query: 175 VFEYFDDENYFQINDEGAHIFLKPMGY 255 F+YFD E ++ E + LK GY Sbjct: 238 -FDYFDQEKNGWLDYEHFELCLKSQGY 263 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 12, 1999 12:54 PM Number of letters in database: 112,640,273 Number of sequences in database: 368,476 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78186728 Number of Sequences: 368476 Number of extensions: 1122453 Number of successful extensions: 2885 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2885 Number of HSP's gapped (non-prelim): 1 length of query: 231 length of database: 112640273 effective HSP length: 53 effective length of query: 177 effective length of database: 93111045 effective search space: 16480654965 effective search space used: 16480654965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 68 (30.9 bits)