BLASTX 2.0.8 [Jan-05-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 14VII55R
         (573 letters)

Database: Non-redundant GenBank CDS
translations+PDB+SwissProt+SPupdate+PIR
           369,800 sequences; 113,023,754 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gi|1171589|emb|CAA64574| (X95275) frameshift [Plasmodium falcipa...    31  7.1


>gi|1171589|emb|CAA64574| (X95275) frameshift [Plasmodium falciparum] Length = 960 Score = 30.9 bits (68), Expect = 7.1 Identities = 29/102 (28%), Positives = 41/102 (39%), Gaps = 5/102 (4%) Query: 75 NFVFLIHIISNNYYAFIKN*L***NI*QIKIN---NLRILYNRYKYNILKNFIFSCSLS- 242 NF+ I NNYY + N N+ Q N N +LYN+ YN + N I++ L+ Sbjct: 648 NFIHNHIIYKNNYYIYNNNM----NLYQYNKNILINNNLLYNKLFYNYINNNIYNLYLND 703 Query: 243 -TIYKKEISXXXXXXXXXXXXXXXXXXXXXXXXXLYYRYKXNIFKIF 380 TI + I+ YY Y NI I+ Sbjct: 704 ITIGLQSINIIFENKNIKDNIFFISNNIYVIFYIKYYNYLNNIIYIY 750 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 17, 1999 5:33 AM Number of letters in database: 113,023,754 Number of sequences in database: 369,800 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56118302 Number of Sequences: 369800 Number of extensions: 644049 Number of successful extensions: 931 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 927 Number of HSP's gapped (non-prelim): 4 length of query: 191 length of database: 113023754 effective HSP length: 53 effective length of query: 137 effective length of database: 93424354 effective search space: 12799136498 effective search space used: 12799136498 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 67 (30.5 bits)