BLASTX 2.0.8 [Jan-05-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 14VII43R
         (357 letters)

Database: Non-redundant GenBank CDS
translations+PDB+SwissProt+SPupdate+PIR
           368,476 sequences; 112,640,273 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gi|505102|dbj|BAA06685| (D31887) KIAA0062 [Homo sapiens]               32  1.6
gi|4493891|emb|CAB39000| (AL034558) predicted using hexExon; MAL...    31  3.5


>gi|505102|dbj|BAA06685| (D31887) KIAA0062 [Homo sapiens] Length = 531 Score = 32.1 bits (71), Expect = 1.6 Identities = 11/35 (31%), Positives = 21/35 (59%) Query: 187 YYILCITMCHLCNIISVKNREIIKHCFFNRTIIYF 83 Y +LC+T+ LC+++ +K F+ R ++YF Sbjct: 195 YGLLCVTVISLCSLLGASVVPFMKKTFYKRLLLYF 229
>gi|4493891|emb|CAB39000| (AL034558) predicted using hexExon; MAL3P2.13 (PFC0220w), Hypothetical protein, len: 1570 [Plasmodium falciparum] Length = 1569 Score = 30.9 bits (68), Expect = 3.5 Identities = 16/40 (40%), Positives = 22/40 (55%) Query: 65 YSHHLFKVNNSSIEETMLYYFPILNRYYITQMTHGDTEDI 184 Y H FK + I E LY + IL +YY TH +++DI Sbjct: 1409 YCHIFFKCIINLIHENCLYLYHILKKYY----THNNSKDI 1444 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 12, 1999 12:54 PM Number of letters in database: 112,640,273 Number of sequences in database: 368,476 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40565555 Number of Sequences: 368476 Number of extensions: 569659 Number of successful extensions: 1383 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1381 Number of HSP's gapped (non-prelim): 3 length of query: 119 length of database: 112640273 effective HSP length: 51 effective length of query: 67 effective length of database: 93847997 effective search space: 6287815799 effective search space used: 6287815799 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 64 (29.3 bits)