BLASTX 2.0.8 [Jan-05-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 14VII29R
         (692 letters)

Database: Non-redundant GenBank CDS
translations+PDB+SwissProt+SPupdate+PIR
           369,800 sequences; 113,023,754 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gi|3845218 (AE001403) predicted secreted protein [Plasmodium fal...    34  0.81
gi|3845167 (AE001390) hypothetical protein [Plasmodium falciparum]     31  9.2
gi|3037018 (AF041330) NADH dehydrogenase subunit 5 [Bodo saltans]      31  9.2


>gi|3845218 (AE001403) predicted secreted protein [Plasmodium falciparum] Length = 1817 Score = 34.4 bits (77), Expect = 0.81 Identities = 14/41 (34%), Positives = 23/41 (55%) Query: 529 ILFYFYK*SLITYILRNRYTAKSYEKHINQYKYFIINFKNI 407 I F+F+ +LI Y +N + +E HI+QY YF + + Sbjct: 504 INFHFFIFNLILYKCKNEFPCSIFELHISQYLYFFVKLNEL 544
>gi|3845167 (AE001390) hypothetical protein [Plasmodium falciparum] Length = 1802 Score = 30.9 bits (68), Expect = 9.2 Identities = 30/69 (43%), Positives = 40/69 (57%), Gaps = 24/69 (34%) Query: 279 HNLYF*NLKFKLDT--NNIRNNKYIK*QRYNNLFR-----NIAIVKNICNMF-------- 413 +NL+F K +L T NNI+ + I YNN++ I + NICN Sbjct: 788 NNLFFDKFKKELITLYNNIKTDHMIS-SNYNNMYELINTNMIFLSSNICNTIFDNPFKKD 846 Query: 414 -------LKLIIKYLYWF--ICFSYDFAVYLFL 485 L II YL IC SYD + +FL Sbjct: 847 TYIPLNKLITIIHYLDKINKICLSYDHTINIFL 879
>gi|3037018 (AF041330) NADH dehydrogenase subunit 5 [Bodo saltans] Length = 212 Score = 30.9 bits (68), Expect = 9.2 Identities = 13/37 (35%), Positives = 20/37 (53%) Query: 217 MYCLLFFTILKFIYFNYNSSQYFLLLYKCFYSFLYFF 107 MYCL FF+ F++ +F+ CFY L+F+ Sbjct: 113 MYCLFFFSFFDFVFLCVVFCCFFVF---CFYGCLFFY 146 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 17, 1999 5:33 AM Number of letters in database: 113,023,754 Number of sequences in database: 369,800 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92413535 Number of Sequences: 369800 Number of extensions: 1482169 Number of successful extensions: 3607 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 3603 Number of HSP's gapped (non-prelim): 8 length of query: 230 length of database: 113,023,754 effective HSP length: 53 effective length of query: 177 effective length of database: 93424354 effective search space: 16536110658 effective search space used: 16536110658 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 68 (30.9 bits)