BLASTX 2.0.8 [Jan-05-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 14VII28R
         (659 letters)

Database: Non-redundant GenBank CDS
translations+PDB+SwissProt+SPupdate+PIR
           369,800 sequences; 113,023,754 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gi|322332|pir||S30587 hypothetical protein 4 - Methanobacterium ...    31  6.6


>gi|322332|pir||S30587 hypothetical protein 4 - Methanobacterium thermoautotrophicum >gi|44580|emb|CAA48866| (X69113) orf4 [Methanobacterium thermoautotrophicum] >gi|44586|emb|CAA48864| (X69112) orf4 [Methanobacterium thermoautotrophicum] >gi|2621957 (AE000863) conserved protein [Methanobacterium thermoautotrophicum] Length = 250 Score = 31.3 bits (69), Expect = 6.6 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 10/58 (17%) Query: 604 FLSNIYLLEKLTFIKKEIVNXKRDXIDILNK----------YHEMIKMFDRKTNKDSVDS 455 FL N L K + KEI+ KR+ +D + K + E+ +FD++ N Sbjct: 86 FLQNNSKLIKQEHVSKEIIEEKREELDEIRKSAPFDKCDICFKEVDSLFDKQINLIGSLQ 145 Query: 454 IYRVNKGD 431 IY NK D Sbjct: 146 IYDNNKED 153 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 17, 1999 5:33 AM Number of letters in database: 113,023,754 Number of sequences in database: 369,800 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91436201 Number of Sequences: 369800 Number of extensions: 1375827 Number of successful extensions: 3204 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3204 Number of HSP's gapped (non-prelim): 1 length of query: 219 length of database: 113023754 effective HSP length: 53 effective length of query: 166 effective length of database: 93424354 effective search space: 15508442764 effective search space used: 15508442764 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 68 (30.9 bits)