BLASTX 2.0.8 [Jan-05-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 14VII28R
         (659 letters)

Database: Non-redundant GenBank CDS
translations+PDB+SwissProt+SPupdate+PIR
           369,800 sequences; 113,023,754 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gi|322332|pir||S30587 hypothetical protein 4 - Methanobacterium ...    31  6.6


>gi|322332|pir||S30587 hypothetical protein 4 - Methanobacterium thermoautotrophicum
           >gi|44580|emb|CAA48866| (X69113) orf4 [Methanobacterium
           thermoautotrophicum] >gi|44586|emb|CAA48864| (X69112)
           orf4 [Methanobacterium thermoautotrophicum] >gi|2621957
           (AE000863) conserved protein [Methanobacterium
           thermoautotrophicum]
           Length = 250
           
 Score = 31.3 bits (69), Expect = 6.6
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 10/58 (17%)

Query: 604 FLSNIYLLEKLTFIKKEIVNXKRDXIDILNK----------YHEMIKMFDRKTNKDSVDS 455
           FL N   L K   + KEI+  KR+ +D + K          + E+  +FD++ N      
Sbjct: 86  FLQNNSKLIKQEHVSKEIIEEKREELDEIRKSAPFDKCDICFKEVDSLFDKQINLIGSLQ 145

Query: 454 IYRVNKGD 431
           IY  NK D
Sbjct: 146 IYDNNKED 153


  Database: Non-redundant GenBank CDS
  translations+PDB+SwissProt+SPupdate+PIR
    Posted date:  Apr 17, 1999  5:33 AM
  Number of letters in database: 113,023,754
  Number of sequences in database:  369,800
  
Lambda     K      H
   0.318    0.135     0.00 

Gapped
Lambda     K      H
   0.270   0.0470 4.94e-324 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 91436201
Number of Sequences: 369800
Number of extensions: 1375827
Number of successful extensions: 3204
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 3204
Number of HSP's gapped (non-prelim): 1
length of query: 219
length of database: 113023754
effective HSP length: 53
effective length of query: 166
effective length of database: 93424354
effective search space: 15508442764
effective search space used: 15508442764
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.7 bits)
S2: 68 (30.9 bits)