BLASTX 2.0.8 [Jan-05-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 14VII-50F (599 letters) Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR 368,476 sequences; 112,640,273 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value gi|549112|sp|Q05501|TRAD_BACTF TRANSPOSASE FOR INSERTION SEQUENC... 31 5.8
>gi|549112|sp|Q05501|TRAD_BACTF TRANSPOSASE FOR INSERTION SEQUENCE ELEMENT IS231D >gi|282463|pir||S25199 transposase (insertion sequence IS231D) - Bacillus thuringiensis subsp. finitimus >gi|40304|emb|CAA44989| (X63383) transposase [Bacillus thuringiensis] Length = 478 Score = 31.3 bits (69), Expect = 5.8 Identities = 18/44 (40%), Positives = 26/44 (58%) Query: 419 KIFLTLFFRNKKNGNEFHKIYY*LNLLFFFIHYIHEYTIFLKQK 550 KIF+ LF KKNG + H+ Y +F + I+EY+ F KQ+ Sbjct: 434 KIFIRLFTLLKKNGRKSHR--YEKKTVFDIMGVIYEYSGFKKQQ 475 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 12, 1999 12:54 PM Number of letters in database: 112,640,273 Number of sequences in database: 368,476 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64265264 Number of Sequences: 368476 Number of extensions: 814806 Number of successful extensions: 1063 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1063 Number of HSP's gapped (non-prelim): 1 length of query: 199 length of database: 112640273 effective HSP length: 53 effective length of query: 146 effective length of database: 93111045 effective search space: 13594212570 effective search space used: 13594212570 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 67 (30.5 bits)