BLASTX 2.0.8 [Jan-05-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 14-19R
         (781 letters)

Database: Non-redundant GenBank CDS
translations+PDB+SwissProt+SPupdate+PIR
           368,476 sequences; 112,640,273 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gi|2429545 (AF025472) Similar to reverse transcriptase [Caenorha...    31  8.1


>gi|2429545 (AF025472) Similar to reverse transcriptase [Caenorhabditis elegans] Length = 743 Score = 31.3 bits (69), Expect = 8.1 Identities = 16/58 (27%), Positives = 33/58 (56%), Gaps = 4/58 (6%) Query: 540 IFKPRK*IKP----NLIYEYKIFEIFFYLFRKKVSANTSFSLQIFVSFSFDIIIAYFNLK 373 +FK R+ +K N+++ +K+F + R K A + F + F+ F ++ ++NL+ Sbjct: 667 MFKCRQILKNFRSLNMMFYFKLFNTYQPFARAKARAPSGFVVSRFLKHIFSLVFEFYNLR 726 Query: 372 QK 367 K Sbjct: 727 LK 728 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 12, 1999 12:54 PM Number of letters in database: 112,640,273 Number of sequences in database: 368,476 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 141351018 Number of Sequences: 368476 Number of extensions: 2715034 Number of successful extensions: 5311 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5310 Number of HSP's gapped (non-prelim): 1 length of query: 260 length of database: 112640273 effective HSP length: 54 effective length of query: 205 effective length of database: 92742569 effective search space: 19012226645 effective search space used: 19012226645 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 68 (30.9 bits)