BLASTX 2.0.8 [Jan-05-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 12VII12R (690 letters) Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR 369,800 sequences; 113,023,754 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|2982975 (AE000681) hypothetical protein [Aquifex aeolicus] 32 3.1 gi|3845174 (AE001392) PfS230 paralog (predicted secreted protein... 32 4.1 gi|3758843|emb|CAB11128| (Z98551) predicted using hexExon; MAL3P... 31 7.0 gi|2702395 (AF038608) No definition line found [Caenorhabditis e... 31 7.0 gi|2688577 (AE001166) serine/threonine kinase, putative [Borreli... 31 9.1 gi|3661535 (AF090118) heat shock protein hsp104 [Plasmodium falc... 31 9.1
>gi|2982975 (AE000681) hypothetical protein [Aquifex aeolicus] Length = 338 Score = 32.5 bits (72), Expect = 3.1 Identities = 23/86 (26%), Positives = 41/86 (46%), Gaps = 1/86 (1%) Query: 397 NLTSN*MSKGFNQIA*DYEDF-ILQTIISYFKKIENNINDYYNTSIHHISLKILESSTKK 573 N+ SN + + +++ ED L+ + + KKI N +ND N + S + K Sbjct: 58 NILSNILIRELERVSEKKEDIKFLRRELKFLKKIRNRLNDLTNLEKRDAYI----SLSGK 113 Query: 574 IVKY*NTLRTEMNILKVQPGKSNEKIK 654 ++Y LR +N+LK K E ++ Sbjct: 114 RIRYKKVLRDTLNLLKDLKAKLIENVE 140
>gi|3845174 (AE001392) PfS230 paralog (predicted secreted protein) [Plasmodium falciparum] Length = 2496 Score = 32.1 bits (71), Expect = 4.1 Identities = 24/74 (32%), Positives = 44/74 (59%), Gaps = 4/74 (5%) Query: 463 LQTIISYFKKIENNINDYYNT----SIHHISLKILESSTKKIVKY*NTLRTEMNILKVQP 630 +Q ++ + KI ++D YNT + I LK+ + KK KY + L+ ++N K + Sbjct: 1600 VQNVLERYLKI---LSDLYNTHEEFTYFSIHLKLKKEIMKK--KYIDYLKKKINEYKEK- 1653 Query: 631 GKSNEKIKDITLQINDKV 684 ++++KIK +TL ND + Sbjct: 1654 -ETSDKIKRVTLSTNDNI 1670
>gi|3758843|emb|CAB11128| (Z98551) predicted using hexExon; MAL3P6.23 (PFC0820w), Hypothetical protein, len: 4982 aa [Plasmodium falciparum] Length = 4981 Score = 31.3 bits (69), Expect = 7.0 Identities = 25/96 (26%), Positives = 44/96 (45%) Query: 382 VISTYNLTSN*MSKGFNQIA*DYEDFILQTIISYFKKIENNINDYYNTSIHHISLKILES 561 VIS +++TSN N I + + +I + + N D + +++ +I +K E Sbjct: 4475 VISDFHITSN------NNITRSFTATLTDSIFNTLSETLNYSYDNFFSNMDNIKIKKNEI 4528 Query: 562 STKKIVKY*NTLRTEMNILKVQPGKSNEKIKDITLQ 669 + V Y N N LKV+ K NE+ + T + Sbjct: 4529 NNITDVDYGNKKEYHENYLKVKQNKVNEEYIEETFK 4564
>gi|2702395 (AF038608) No definition line found [Caenorhabditis elegans] Length = 606 Score = 31.3 bits (69), Expect = 7.0 Identities = 13/35 (37%), Positives = 20/35 (57%) Query: 117 KRSSYRDNSFNFPIIFLAWFTFTNHFLKLFISYIF 13 K S F+ P I++ W + HF+K FISY++ Sbjct: 294 KLSQLTSAQFHSPHIYIFWQSIVVHFIKEFISYLY 328
>gi|2688577 (AE001166) serine/threonine kinase, putative [Borrelia burgdorferi] Length = 562 Score = 30.9 bits (68), Expect = 9.1 Identities = 24/85 (28%), Positives = 46/85 (53%) Query: 427 FNQIA*DYEDFILQTIISYFKKIENNINDYYNTSIHHISLKILESSTKKIVKY*NTLRTE 606 F +I Y++ L+ + Y K +ENN+ ++ I ++ L + +I K+ N+L+ + Sbjct: 189 FYEIKETYDNQELKNFLLYLKALENNL---HSIKIQNLEGSKLTTELLEIPKF-NSLKEQ 244 Query: 607 MNILKVQPGKSNEKIKDITLQINDK 681 I+ Q N+++KD QIN+K Sbjct: 245 EPIINFQ----NKRLKD--YQINEK 263
>gi|3661535 (AF090118) heat shock protein hsp104 [Plasmodium falciparum] Length = 752 Score = 30.9 bits (68), Expect = 9.1 Identities = 20/75 (26%), Positives = 37/75 (48%) Query: 463 LQTIISYFKKIENNINDYYNTSIHHISLKILESSTKKIVKY*NTLRTEMNILKVQPGKSN 642 LQT++S K+++ ND Y SI H+ L I+ +K + L+ +N K++ + N Sbjct: 96 LQTVLSTSKRLKKEFNDEY-ISIEHLLLSIISEDSKFTRPW--LLKYNVNYEKLKSCRKN 152 Query: 643 EKIKDITLQINDKVY 687 + K + + Y Sbjct: 153 SRKKKSYFKTPEMTY 167 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 17, 1999 5:33 AM Number of letters in database: 113,023,754 Number of sequences in database: 369,800 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 118516558 Number of Sequences: 369800 Number of extensions: 2239211 Number of successful extensions: 5276 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 5272 Number of HSP's gapped (non-prelim): 9 length of query: 230 length of database: 113023754 effective HSP length: 53 effective length of query: 176 effective length of database: 93424354 effective search space: 16442686304 effective search space used: 16442686304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 68 (30.9 bits)