BLASTX 2.0.8 [Jan-05-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 12VII-9 (613 letters) Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR 369,800 sequences; 113,023,754 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|3881836|emb|CAB01454| (Z78019) Similarity to Yeast LPG22P pro... 56 2e-07 gi|2239229|emb|CAB10146| (Z97210) hypothetical protein [Schizosa... 56 2e-07 gi|2132182|pir||S61980 hypothetical protein YPL086c - yeast (Sac... 39 0.020 gi|4481958|emb|CAA21921| (AL033389) putative transcriptional reg... 34 1.2
>gi|3881836|emb|CAB01454| (Z78019) Similarity to Yeast LPG22P protein (TR:G1151240); cDNA EST EMBL:T00686 comes from this gene; cDNA EST EMBL:C12415 comes from this gene; cDNA EST EMBL:C12728 comes from this gene; cDNA EST EMBL:C10626 comes from this ge... Length = 554 Score = 56.2 bits (133), Expect = 2e-07 Identities = 30/64 (46%), Positives = 44/64 (67%), Gaps = 3/64 (4%) Query: 421 NEIVQRIVSLHNKNKKWDFNSIKSSVCKX--YSVMPRLVDIISAIPPEYSD-LVHLLRAK 591 NEIV+ ++ HN+ K + N +K V + S P+LVDII+ +P +Y D L+ L+AK Sbjct: 23 NEIVKLLIEAHNQKKDVNLNRLKCIVAQKNGLSFQPKLVDIIAGVPSDYKDSLLPKLKAK 82 Query: 592 PVRTSSG 612 PVRT+SG Sbjct: 83 PVRTASG 89
>gi|2239229|emb|CAB10146| (Z97210) hypothetical protein [Schizosaccharomyces pombe] Length = 544 Score = 55.8 bits (132), Expect = 2e-07 Identities = 32/66 (48%), Positives = 45/66 (67%), Gaps = 5/66 (7%) Query: 415 AANEIVQRIVSLHNKNKKWDFNSIKSSVCKXY--SVMPRLVDIISAIPPE---YSDLVHL 579 A EIV +++ N+NK + N++K + K + S PRL DII+AIPP+ L+ Sbjct: 13 ACAEIVAELIASENQNKVINLNALKMRISKKHQLSESPRLTDIIAAIPPDAYLKESLMRK 72 Query: 580 LRAKPVRTSSG 612 LRAKPVRT+SG Sbjct: 73 LRAKPVRTASG 83
>gi|2132182|pir||S61980 hypothetical protein YPL086c - yeast (Saccharomyces cerevisiae) >gi|1151240 (U43281) Lpg22p [Saccharomyces cerevisiae] Length = 557 Score = 39.5 bits (90), Expect = 0.020 Identities = 22/47 (46%), Positives = 32/47 (67%), Gaps = 3/47 (6%) Query: 472 DFNSIKSSVCKXYSV--MPRLVDIISAIPPEYSD-LVHLLRAKPVRTSSG 612 + N + + K Y + PRL DII++IP +Y L+ L+AKPVRT+SG Sbjct: 46 NLNGLITKYSKKYKLKQQPRLTDIINSIPDQYKKYLLPKLKAKPVRTASG 95
>gi|4481958|emb|CAA21921| (AL033389) putative transcriptional regulator, zinc-finger, binuclear cluster domain containing [Schizosaccharomyces pombe] Length = 595 Score = 33.6 bits (75), Expect = 1.2 Identities = 23/79 (29%), Positives = 38/79 (47%) Query: 243 HLSFFCYIVFKYFLCCLSAMKEFNDLENAISKKDIIEILSVYAKFLEGIVNDMXXVEVED 64 +L F Y F FL S + E +DL+ I KD+ + S++A FL+ + D+ E Sbjct: 502 YLWLFLYCPFTPFLTVFSHLLEDDDLDADICVKDVDRLYSIHAFFLK--MKDISGEFAER 559 Query: 63 INKLMENIQIKRNVYSAAE 7 ++ + EN Y A + Sbjct: 560 LSVITENFIQSAEQYLALQ 578 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 17, 1999 5:33 AM Number of letters in database: 113,023,754 Number of sequences in database: 369,800 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90914658 Number of Sequences: 369800 Number of extensions: 1503759 Number of successful extensions: 3636 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 3629 Number of HSP's gapped (non-prelim): 6 length of query: 204 length of database: 113023754 effective HSP length: 53 effective length of query: 150 effective length of database: 93424354 effective search space: 14013653100 effective search space used: 14013653100 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 67 (30.5 bits)