BLASTX 2.0.8 [Jan-05-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 12VII-30R
         (750 letters)

Database: Non-redundant GenBank CDS
translations+PDB+SwissProt+SPupdate+PIR
           368,476 sequences; 112,640,273 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gi|262249|bbs|121221 (S52010) orf1 5' of EpoR [mice, Peptide, 85...    32  4.5


>gi|262249|bbs|121221 (S52010) orf1 5' of EpoR [mice, Peptide, 85 aa] [Mus sp.]
           Length = 85
           
 Score = 32.1 bits (71), Expect = 4.5
 Identities = 14/51 (27%), Positives = 29/51 (56%)

Query: 35  LYVYLINMCITCTINRTIVQYSLYIRYSYITKFIFYFIKR*IYVFMVTFMY 187
           +YVY+ N+C+  +I   I  +     Y+Y+ ++ + ++   +Y +M  FMY
Sbjct: 1   MYVYM-NVCMYSSICLPICPWVCQCMYAYVNQYTYLYLCICVYPYMCLFMY 50


  Database: Non-redundant GenBank CDS
  translations+PDB+SwissProt+SPupdate+PIR
    Posted date:  Apr 12, 1999 12:54 PM
  Number of letters in database: 112,640,273
  Number of sequences in database:  368,476
  
Lambda     K      H
   0.318    0.135     0.00 

Gapped
Lambda     K      H
   0.270   0.0470 4.94e-324 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 122797593
Number of Sequences: 368476
Number of extensions: 2242065
Number of successful extensions: 4833
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 4832
Number of HSP's gapped (non-prelim): 2
length of query: 250
length of database: 112640273
effective HSP length: 53
effective length of query: 196
effective length of database: 93111045
effective search space: 18249764820
effective search space used: 18249764820
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.7 bits)
S2: 68 (30.9 bits)