BLASTX 2.0.8 [Jan-05-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 12VII-30R (750 letters) Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR 368,476 sequences; 112,640,273 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value gi|262249|bbs|121221 (S52010) orf1 5' of EpoR [mice, Peptide, 85... 32 4.5
>gi|262249|bbs|121221 (S52010) orf1 5' of EpoR [mice, Peptide, 85 aa] [Mus sp.] Length = 85 Score = 32.1 bits (71), Expect = 4.5 Identities = 14/51 (27%), Positives = 29/51 (56%) Query: 35 LYVYLINMCITCTINRTIVQYSLYIRYSYITKFIFYFIKR*IYVFMVTFMY 187 +YVY+ N+C+ +I I + Y+Y+ ++ + ++ +Y +M FMY Sbjct: 1 MYVYM-NVCMYSSICLPICPWVCQCMYAYVNQYTYLYLCICVYPYMCLFMY 50 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 12, 1999 12:54 PM Number of letters in database: 112,640,273 Number of sequences in database: 368,476 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 122797593 Number of Sequences: 368476 Number of extensions: 2242065 Number of successful extensions: 4833 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4832 Number of HSP's gapped (non-prelim): 2 length of query: 250 length of database: 112640273 effective HSP length: 53 effective length of query: 196 effective length of database: 93111045 effective search space: 18249764820 effective search space used: 18249764820 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 68 (30.9 bits)