BLASTX 2.0.8 [Jan-05-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 12VII-28F (492 letters) Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR 369,800 sequences; 113,023,754 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|130593|sp|P05400|POL_CERV ENZYMATIC POLYPROTEIN [CONTAINS: AS... 38 0.045 gi|2791289|emb|CAA04050| (AJ000387) protease [Drosophila melanog... 33 1.1 gi|2147955|pir||S68349 pol polyprotein - Tribolium freemani retr... 33 1.5 gi|2147954|pir||S68350 pol polyprotein - Tribolium brevicornis r... 33 1.5 gi|4235644 (AF119040) polyprotein [Lycopersicon esculentum] 32 2.6 gi|102939|pir||B36329 hypothetical protein 2 - cabbage looper tr... 31 4.4 gi|1226168 (M32662) ORF B (bases 1850-5560) first start codon at... 31 4.4 gi|130405|sp|P04323|POL3_DROME RETROVIRUS-RELATED POL POLYPROTEI... 31 7.6
>gi|130593|sp|P05400|POL_CERV ENZYMATIC POLYPROTEIN [CONTAINS: ASPARTIC PROTEASE ; ENDONUCLEASE; REVERSE TRANSCRIPTASE ] >gi|76775|pir||S00854 hypothetical protein 5 - carnation etched ring virus >gi|58863|emb|CAA28360| (X04658) pot. ORF 5 (AA 1-659) [Carnation etched ring virus] >gi|225356|prf||1301227E ORF 5 [Carnation etched ring virus] Length = 659 Score = 37.9 bits (86), Expect = 0.045 Identities = 27/85 (31%), Positives = 43/85 (49%), Gaps = 18/85 (21%) Query: 365 IHKSNETVHKYSI------------IEK*FYVIYKTIEIFKILFSCVNIIISADNKNLIS 222 IH S+E + +Y+ EK + + I+ F I + +I DNKN Sbjct: 548 IHNSHEYICRYASGSFKAAERNYHSNEKELLAVIRVIKKFSIYLTPSRFLIRTDNKNFTH 607 Query: 221 LVKTHLQ------KIAKWEEHLISYDISV*YIKRTHNTSVTFL 111 V +L+ ++ +W+ L YD V +I T N FL Sbjct: 608 FVNINLKGDRKQGRLVRWQMWLSQYDFDVEHIAGTKNVFADFL 650
>gi|2791289|emb|CAA04050| (AJ000387) protease [Drosophila melanogaster] Length = 1217 Score = 33.2 bits (74), Expect = 1.1 Identities = 23/75 (30%), Positives = 36/75 (47%), Gaps = 2/75 (2%) Query: 353 NETVHKYSIIEK*FYVIYKTIEIFKILFSCVNIIISADNKNLISLV--KTHLQKIAKWEE 180 ++T YS IEK I ++ F+ V I D+K LI L+ K KI +W Sbjct: 651 SDTEVNYSTIEKEMLAIIWAVKYFRPYIYGVKFTIVTDHKPLIWLMNFKEPNSKIIRWRL 710 Query: 179 HLISYDISV*YIKRTHN 129 L+ Y+ + + K + N Sbjct: 711 QLMEYNFEIIHKKGSQN 727
>gi|2147955|pir||S68349 pol polyprotein - Tribolium freemani retrotransposon Woot (fragment) >gi|1117950 (U40764) polyprotein [Tribolium freemani] Length = 190 Score = 32.8 bits (73), Expect = 1.5 Identities = 26/107 (24%), Positives = 47/107 (43%), Gaps = 11/107 (10%) Query: 335 YSIIEK*FYVIYKTIEIFKILFSCVNIIISADNKNLISLVKTHL--QKIAKWEEHLISYD 162 Y+ EK + + F+I III D++ L L + L +++ +W L YD Sbjct: 64 YTTTEKELLGVIFALHKFRIYIQATKIIIRTDHQALKFLSRCRLLSERLTRWTLILGQYD 123 Query: 161 ISV*YIKRTHNTSVTFLPKY---------FTPEGNIPTLLEY*NGTKLILIRNDMNFH 15 + +K N L +Y + E I + E N +++ + D+ H Sbjct: 124 YEIELVKGKDNVVADILSRYPSDGEASYEYPREQPIVAMFEVHNTPEILQLMTDLKQH 181
>gi|2147954|pir||S68350 pol polyprotein - Tribolium brevicornis retrotransposon Woot (fragment) >gi|1117948 (U40765) polyprotein [Tribolium brevicornis] Length = 203 Score = 32.8 bits (73), Expect = 1.5 Identities = 25/107 (23%), Positives = 48/107 (44%), Gaps = 11/107 (10%) Query: 335 YSIIEK*FYVIYKTIEIFKILFSCVNIIISADNKNLISLVKTHL--QKIAKWEEHLISYD 162 Y+ EK + + F+I I+I D++ L L + L +++ +W L YD Sbjct: 67 YTTTEKELLGVIFALHKFRIYIQATKIVIRTDHQALRFLGRCRLLSERLTRWTLLLGQYD 126 Query: 161 ISV*YIKRTHNTSVTFLPKY---------FTPEGNIPTLLEY*NGTKLILIRNDMNFH 15 + +K N + L +Y + E I + E N +++ + D+ H Sbjct: 127 YEIELVKGKDNVAADILSRYPSDGDASYEYPREQPIVAMFEVHNTPEILQLLRDLKQH 184
>gi|4235644 (AF119040) polyprotein [Lycopersicon esculentum] Length = 1542 Score = 32.1 bits (71), Expect = 2.6 Identities = 18/77 (23%), Positives = 32/77 (41%), Gaps = 2/77 (2%) Query: 359 KSNETVHKYSIIEK*FYVIYKTIEIFKILFSCVNIIISADN--KNLISLVKTHLQKIAKW 186 K N+ +YS EK + ++++++ ++ DN K K A+W Sbjct: 936 KLNDAEQRYSTHEKEMVAVVHCLQVWRVYLLGTRFVVRTDNVANTFFKTQKKLSPKQARW 995 Query: 185 EEHLISYDISV*YIKRTHN 129 +E L YD + HN Sbjct: 996 QEFLAEYDFMWEHKPGKHN 1014
>gi|102939|pir||B36329 hypothetical protein 2 - cabbage looper transposon TED (fragment) Length = 1236 Score = 31.3 bits (69), Expect = 4.4 Identities = 25/83 (30%), Positives = 36/83 (43%), Gaps = 2/83 (2%) Query: 353 NETVHKYSIIEK*FYVIYKTIEIFKILFSCVNIIISADNKNL--ISLVKTHLQKIAKWEE 180 NE+ YS IEK I + F+ I D+K L + +K ++ +W Sbjct: 625 NESELNYSTIEKELLAIVWATKYFRPYLFGRKFKILTDHKPLQWMMNLKDPNSRMTRWRL 684 Query: 179 HLISYDISV*YIKRTHNTSVTFLPK 105 L YD SV Y K NT+ L + Sbjct: 685 RLSEYDFSVVYKKGKSNTNADALSR 709
>gi|1226168 (M32662) ORF B (bases 1850-5560) first start codon at 2306 [Autographa californica nucleopolyhedrovirus] Length = 1084 Score = 31.3 bits (69), Expect = 4.4 Identities = 25/83 (30%), Positives = 36/83 (43%), Gaps = 2/83 (2%) Query: 353 NETVHKYSIIEK*FYVIYKTIEIFKILFSCVNIIISADNKNL--ISLVKTHLQKIAKWEE 180 NE+ YS IEK I + F+ I D+K L + +K ++ +W Sbjct: 473 NESELNYSTIEKELLAIVWATKYFRPYLFGRKFKILTDHKPLQWMMNLKDPNSRMTRWRL 532 Query: 179 HLISYDISV*YIKRTHNTSVTFLPK 105 L YD SV Y K NT+ L + Sbjct: 533 RLSEYDFSVVYKKGKSNTNADALSR 557
>gi|130405|sp|P04323|POL3_DROME RETROVIRUS-RELATED POL POLYPROTEIN FROM TRANSPOSON 17.6 [CONTAINS: PROTEASE ; REVERSE TRANSCRIPTASE ; ENDONUCLEASE] >gi|74642|pir||GNFF17 retrovirus-related pol polyprotein - fruit fly (Drosophila melanogaster) transposon 17.6 >gi|1335613|emb|CAA25702| (X01472) ORF 2, pot. reverse transcriptase [Drosophila melanogaster] >gi|224319|prf||1101404B ORF 2 [Drosophila melanogaster] Length = 1058 Score = 30.5 bits (67), Expect = 7.6 Identities = 23/75 (30%), Positives = 34/75 (44%), Gaps = 2/75 (2%) Query: 353 NETVHKYSIIEK*FYVIYKTIEIFKILFSCVNIIISADNKNLISL--VKTHLQKIAKWEE 180 NE YS IEK I + F+ + IS+D++ L L +K K+ +W Sbjct: 539 NEHEINYSTIEKELLAIVWATKTFRHYLLGRHFEISSDHQPLSWLYRMKDPNSKLTRWRV 598 Query: 179 HLISYDISV*YIKRTHN 129 L +D + YIK N Sbjct: 599 KLSEFDFDIKYIKGKEN 615 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 17, 1999 5:33 AM Number of letters in database: 113,023,754 Number of sequences in database: 369,800 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93351228 Number of Sequences: 369800 Number of extensions: 1798111 Number of successful extensions: 3941 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 3940 Number of HSP's gapped (non-prelim): 8 length of query: 164 length of database: 113023754 effective HSP length: 52 effective length of query: 111 effective length of database: 93794154 effective search space: 10411151094 effective search space used: 10411151094 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 66 (30.1 bits)