BLASTX 2.0.8 [Jan-05-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 12VII-25R
         (721 letters)

Database: Non-redundant GenBank CDS
translations+PDB+SwissProt+SPupdate+PIR
           368,476 sequences; 112,640,273 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gi|1176864|sp|P45800|YRFF_ECOLI HYPOTHETICAL 79.5 KD PROTEIN IN ...    31  9.6


>gi|1176864|sp|P45800|YRFF_ECOLI HYPOTHETICAL 79.5 KD PROTEIN IN MRCA-PCKA INTERGENIC REGION (O711) >gi|606332 (U18997) ORF_o711 [Escherichia coli] >gi|1789801 (AE000415) putative dehydrogenase [Escherichia coli] Length = 711 Score = 30.9 bits (68), Expect = 9.6 Identities = 15/44 (34%), Positives = 30/44 (68%), Gaps = 7/44 (15%) Query: 415 PLKVLLSWILLSEFLRAST--NHSNAGTNLSN-----GSGLCGVSTAATWN 546 PLK LSW+ ++ + A++ ++AG + + G+G+C + T+ TW+ Sbjct: 363 PLKFTLSWMKGAQTIEATSVKQLADAGVRVGDTLRISGTGMCNIRTSGTWS 413 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 12, 1999 12:54 PM Number of letters in database: 112,640,273 Number of sequences in database: 368,476 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 136521021 Number of Sequences: 368476 Number of extensions: 2611124 Number of successful extensions: 7210 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7210 Number of HSP's gapped (non-prelim): 1 length of query: 240 length of database: 112640273 effective HSP length: 53 effective length of query: 186 effective length of database: 93111045 effective search space: 17318654370 effective search space used: 17318654370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 68 (30.9 bits)