BLASTX 2.0.8 [Jan-05-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 12VII-10R
         (602 letters)

Database: Non-redundant GenBank CDS
translations+PDB+SwissProt+SPupdate+PIR
           369,800 sequences; 113,023,754 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gi|3293522 (AF069195) NADH dehydrogenase 1 [Praon dorsale]             33  2.0
gi|3649772|emb|CAB11121| (Z98547) predicted using hexExon; MAL3P...    31  7.6
gi|3080535|emb|CAA18663| (AL022600) RNA helicase [Schizosaccharo...    31  7.6


>gi|3293522 (AF069195) NADH dehydrogenase 1 [Praon dorsale] Length = 155 Score = 32.8 bits (73), Expect = 2.0 Identities = 17/53 (32%), Positives = 30/53 (56%) Query: 188 LFIISFLTGCAYSSLRPLAPKARLNSY*LVSLQICINLIYLMLQSVKILRLVY 30 L I + + C+YS L + A+ SY V+ IC+ +I +M+ S+ + L+Y Sbjct: 70 LMIAGWSSNCSYSMLGSMRSVAQSISY-EVTFSICMLIILMMINSINLSNLIY 121
>gi|3649772|emb|CAB11121| (Z98547) predicted using hexExon; MAL3P3.18 (PFC0425w), Hypothetical protein, len: 4551 aa [Plasmodium falciparum] Length = 4550 Score = 30.9 bits (68), Expect = 7.6 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 4/72 (5%) Query: 420 EYLLNKLNSNIFI*HLHLENQKLVDQENFCLHKFYNRANIIPGNHNEIKEHYYLLHKTIP 241 EYLLNK N + + + + N L+K YN+ N N++ IK ++ HK +P Sbjct: 3212 EYLLNKDND--------INDYNIKEYLNEILNK-YNKFNFYENNYDIIKYSTFVDHKIVP 3262 Query: 240 N----NIQQILKNYFF 205 + ++ + K +FF Sbjct: 3263 SVSSFSVFDLYKLFFF 3278
>gi|3080535|emb|CAA18663| (AL022600) RNA helicase [Schizosaccharomyces pombe] Length = 1935 Score = 30.9 bits (68), Expect = 7.6 Identities = 15/47 (31%), Positives = 25/47 (52%) Query: 345 QENFCLHKFYNRANIIPGNHNEIKEHYYLLHKTIPNNIQQILKNYFF 205 +++ C+++ N P I +YYL H TI N +Q+I +N F Sbjct: 1603 EKSACIYRV-NEETYAPTTLGRIVSYYYLFHTTIRNFVQKITENAEF 1648 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 17, 1999 5:33 AM Number of letters in database: 113,023,754 Number of sequences in database: 369,800 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92992929 Number of Sequences: 369800 Number of extensions: 1559125 Number of successful extensions: 3552 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 3549 Number of HSP's gapped (non-prelim): 6 length of query: 200 length of database: 113023754 effective HSP length: 53 effective length of query: 147 effective length of database: 93424354 effective search space: 13733380038 effective search space used: 13733380038 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 67 (30.5 bits)