BLASTX 2.0.8 [Jan-05-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 12VII-10F
         (517 letters)

Database: Non-redundant GenBank CDS
translations+PDB+SwissProt+SPupdate+PIR
           369,800 sequences; 113,023,754 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gi|1171589|emb|CAA64574| (X95275) frameshift [Plasmodium falcipa...    31  8.1


>gi|1171589|emb|CAA64574| (X95275) frameshift [Plasmodium falciparum]
           Length = 960
           
 Score = 30.5 bits (67), Expect = 8.1
 Identities = 24/65 (36%), Positives = 32/65 (48%), Gaps = 3/65 (4%)

Query: 173 NLRILYNRYKYNIFKNFIF---YVLSLLYIRXK*VF*KILIKTNYTVKR**IKISNIFIL 343
           NL  L N+  YN + N +F   Y+L   YI+   ++  I     Y +    IK  N  I 
Sbjct: 379 NLIFLMNKILYN-YNNILFEYKYILQNQYIKCNFIYNSISKNFKYNLNNIIIKYLNNVIK 437

Query: 344 YYRYKSNI 367
           YY Y SNI
Sbjct: 438 YYNY-SNI 444


  Database: Non-redundant GenBank CDS
  translations+PDB+SwissProt+SPupdate+PIR
    Posted date:  Apr 17, 1999  5:33 AM
  Number of letters in database: 113,023,754
  Number of sequences in database:  369,800
  
Lambda     K      H
   0.318    0.135     0.00 

Gapped
Lambda     K      H
   0.270   0.0470 4.94e-324 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 47376326
Number of Sequences: 369800
Number of extensions: 525079
Number of successful extensions: 555
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 553
Number of HSP's gapped (non-prelim): 3
length of query: 172
length of database: 113023754
effective HSP length: 52
effective length of query: 119
effective length of database: 93794154
effective search space: 11161504326
effective search space used: 11161504326
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.7 bits)
S2: 66 (30.1 bits)