BLASTX 2.0.8 [Jan-05-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 12-5F1 (527 letters) Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR 369,800 sequences; 113,023,754 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|4049814 (AF063866) ORF MSV175 putative metalloprotease, simil... 32 3.7
>gi|4049814 (AF063866) ORF MSV175 putative metalloprotease, similar to Bacteroides fragilis GB:U90931 [Melanoplus sanguinipes entomopoxvirus] Length = 221 Score = 31.7 bits (70), Expect = 3.7 Identities = 35/105 (33%), Positives = 54/105 (51%), Gaps = 31/105 (29%) Query: 333 DMYLDYFYDYFSSISILXNCN-------LIKLIDIMDFQVIMNLKY-------------- 217 D+Y D FY Y + S NCN L KL + + +N+K+ Sbjct: 63 DIY-DPFYPYNITTSNSTNCNLEISFNRLYKLARVSKNAIQINIKFVKHFRTIKKNRYLY 121 Query: 216 ------SIQYFIGLKTQEDKFSCGYKYNIKCLYIYSKXXDMYNIFIXESELILATLK--- 64 I +F+GLK DK YK +IY K Y+ ++ + L + ++ Sbjct: 122 VGLFTHQIGHFLGLKDLNDKNDVMYK-----KFIYQKIKKRYDPYMLQKMLSVKNMRKLC 176 Query: 63 TKKKENNH-MSXDMCF 19 K K N H +S C+ Sbjct: 177 KKFKLNQHILSKKWCY 192 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 17, 1999 5:33 AM Number of letters in database: 113,023,754 Number of sequences in database: 369,800 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67884298 Number of Sequences: 369800 Number of extensions: 878819 Number of successful extensions: 2151 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 2150 Number of HSP's gapped (non-prelim): 3 length of query: 175 length of database: 113023754 effective HSP length: 52 effective length of query: 123 effective length of database: 93794154 effective search space: 11536680942 effective search space used: 11536680942 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 66 (30.1 bits)