BLASTX 2.0.8 [Jan-05-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 12-20R (760 letters) Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR 369,800 sequences; 113,023,754 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|3327234|dbj|BAA31685| (AB014610) KIAA0710 protein [Homo sapiens] 32 3.5 gi|2495516|sp|P77393|YAHL_ECOLI HYPOTHETICAL 31.8 KD PROTEIN IN ... 32 4.5 gi|4049768 (AF063866) ORF MSV252 tryptophan repeat gene family p... 32 4.5
>gi|3327234|dbj|BAA31685| (AB014610) KIAA0710 protein [Homo sapiens] Length = 1115 Score = 32.5 bits (72), Expect = 3.5 Identities = 11/22 (50%), Positives = 17/22 (77%) Query: 326 NCLSKIIYFLHNLRVLKQNHIC 391 NC+ +++YFL +R L QNH+C Sbjct: 529 NCMIQVLYFLEPVRCLIQNHLC 550
>gi|2495516|sp|P77393|YAHL_ECOLI HYPOTHETICAL 31.8 KD PROTEIN IN BETT-PRPR INTERGENIC REGION >gi|1657524 (U73857) hypothetical protein [Escherichia coli] >gi|1786519 (AE000139) orf, hypothetical protein [Escherichia coli] Length = 271 Score = 32.1 bits (71), Expect = 4.5 Identities = 15/30 (50%), Positives = 19/30 (63%) Query: 717 VKMAPLHGRFLHLHLVFPFFNESLLYRLLS 628 +K A HG LHL ++P F ESL+ LLS Sbjct: 201 IKQALAHGLLLHLKNIYPVFPESLVMLLLS 230
>gi|4049768 (AF063866) ORF MSV252 tryptophan repeat gene family protein [Melanoplus sanguinipes entomopoxvirus] Length = 161 Score = 32.1 bits (71), Expect = 4.5 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 4/61 (6%) Query: 275 LNINITIKNRIDLENKINC--LSKIIYFLHNLRVLKQNHI--CPLYRKNMKMIRNESSYG 442 +NIN+ I NR+ ++C + K I +N+ + N+I L + +K +NE ++ Sbjct: 72 ININMLIDNRLKFNKNLSCNIIDKYINIYNNIEYINWNNISMLKLTYEFIKKYKNELNWN 131 Query: 443 FILRY 457 I +Y Sbjct: 132 IICKY 136 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 17, 1999 5:33 AM Number of letters in database: 113,023,754 Number of sequences in database: 369,800 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 121438888 Number of Sequences: 369800 Number of extensions: 2094911 Number of successful extensions: 7086 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 7084 Number of HSP's gapped (non-prelim): 4 length of query: 253 length of database: 113023754 effective HSP length: 54 effective length of query: 198 effective length of database: 93054554 effective search space: 18424801692 effective search space used: 18424801692 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 68 (30.9 bits)