BLASTX 2.0.8 [Jan-05-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 11VII6F
         (544 letters)

Database: Non-redundant GenBank CDS
translations+PDB+SwissProt+SPupdate+PIR
           369,800 sequences; 113,023,754 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gi|414322 (L11172) [Plasmodium falciparum RNA polymerase I gene,...    34  0.59
gi|4049799 (AF063866) ORF MSV201 hypothetical protein [Melanoplu...    31  8.7


>gi|414322 (L11172) [Plasmodium falciparum RNA polymerase I gene, complete cds.], gene product [Plasmodium falciparum] Length = 2910 Score = 34.4 bits (77), Expect = 0.59 Identities = 25/78 (32%), Positives = 39/78 (49%), Gaps = 9/78 (11%) Query: 160 EDVFXKKGHSINDLNLFXIIRGNLAELYNLLFRSESCSTAERLNLLVNMKEILNKTL--- 330 + VF K + I+ N F + R + L + LF+ C + N L+NM ++NK L Sbjct: 1751 DHVFYKMEYLIH--NYFYLKRSDFDNLIDSLFQPYLCRVSSGTNNLINMNNLMNKFLNNG 1808 Query: 331 ------TSAKSMKXIMSVLHDLLQHTY 393 T AK K S++ +L Y Sbjct: 1809 FSNMIFTGAKGSKVNYSMICGMLDQQY 1835
>gi|4049799 (AF063866) ORF MSV201 hypothetical protein [Melanoplus sanguinipes entomopoxvirus] Length = 177 Score = 30.5 bits (67), Expect = 8.7 Identities = 22/100 (22%), Positives = 45/100 (45%) Query: 226 NLAELYNLLFRSESCSTAERLNLLVNMKEILNKTLTSAKSMKXIMSVLHDLLQHTYYNRD 405 NL N++ + C +LNLL++ +++LN + + D + H YYN + Sbjct: 12 NLMMFNNMIISNRICIAKYKLNLLLDKEKLLNYDMINK----------IDNIFHEYYNFE 61 Query: 406 YRWSKYINGILIYFNSAIPYSYMENIXLLPEAIDNILPLI 525 + ++ IP + M+ + ++ + NIL +I Sbjct: 62 H-------------SNGIPINIMKLVEIIMDQESNILNII 88 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 17, 1999 5:33 AM Number of letters in database: 113,023,754 Number of sequences in database: 369,800 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85024924 Number of Sequences: 369800 Number of extensions: 1398425 Number of successful extensions: 3042 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3041 Number of HSP's gapped (non-prelim): 2 length of query: 181 length of database: 113023754 effective HSP length: 52 effective length of query: 128 effective length of database: 93794154 effective search space: 12005651712 effective search space used: 12005651712 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 67 (30.5 bits)