BLASTX 2.0.8 [Jan-05-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 11VII26F (658 letters) Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR 369,800 sequences; 113,023,754 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|1352911|sp|P47147|YJ80_YEAST HYPOTHETICAL 80.2 KD PROTEIN IN ... 31 6.5
>gi|1352911|sp|P47147|YJ80_YEAST HYPOTHETICAL 80.2 KD PROTEIN IN CPA2-NNF1 INTERGENIC REGION >gi|1084628|pir||S57131 hypothetical protein YJR110w - yeast (Saccharomyces cerevisiae) >gi|1015824|emb|CAA89640| (Z49610) ORF YJR110w [Saccharomyces cerevisiae] Length = 688 Score = 31.3 bits (69), Expect = 6.5 Identities = 17/56 (30%), Positives = 29/56 (51%) Query: 66 KTGIITLNKNFFIVSDLFNNNFSYNKSNTKFLRYFYSQLSYXXCIYKXLCFXTKIF 233 +T +I L++ +S FN NF NK + KF+ + Q + C+Y+ L +F Sbjct: 492 ETNLINLSR----ISKKFNENFKLNKKSLKFVSPVFQQ--FLDCVYQLLTQNPDLF 541 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 17, 1999 5:33 AM Number of letters in database: 113,023,754 Number of sequences in database: 369,800 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96199855 Number of Sequences: 369800 Number of extensions: 1497265 Number of successful extensions: 2709 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2709 Number of HSP's gapped (non-prelim): 1 length of query: 219 length of database: 113,023,754 effective HSP length: 53 effective length of query: 165 effective length of database: 93424354 effective search space: 15415018410 effective search space used: 15415018410 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 68 (30.9 bits)