BLASTX 2.0.8 [Jan-05-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 11VII-27R
         (769 letters)

Database: Non-redundant GenBank CDS
translations+PDB+SwissProt+SPupdate+PIR
           368,476 sequences; 112,640,273 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gi|4239895|dbj|BAA74737| (AB016816) MASL1 [Homo sapiens]               41  0.009
gi|480379|pir||S36779 ribosome-binding protein p34 - rat >gi|534...    38  0.11
gi|2459628 (U88880) Toll-like receptor 4 [Homo sapiens] >gi|4507...    37  0.18
gi|2429103 (U93091) Toll protein homolog [Homo sapiens]                37  0.18
gi|117793|sp|P23466|CYAA_SACKL ADENYLATE CYCLASE (ATP PYROPHOSPH...    35  0.53
gi|4092774 (AF105140) disease resistance gene homolog 9N [Brassi...    35  0.53
gi|3877646|emb|CAB05742| (Z83230) similar to Leucine Rich Repeat...    35  0.70
gi|3845236 (AE001407) T-complex protein 1 (HSP60 fold superfamil...    35  0.70
gi|171360 (M12057) adenylate cyclase [Saccharomyces cerevisiae]        35  0.70
gi|854568|emb|CAA60917| (X87611) adenylate cyclase [Saccharomyce...    35  0.70
gi|1169151|sp|P08678|CYAA_YEAST ADENYLATE CYCLASE (ATP PYROPHOSP...    35  0.70
gi|2498866|sp|Q15404|RSU1_HUMAN RAS SUPPRESSOR PROTEIN 1 (RSU-1)...    34  0.91
gi|3168891 (AF068716) contains similarity to repeated leucine-ri...    34  0.91
gi|3132526 (AF051151) Toll/interleukin-1 receptor-like protein 3...    34  1.2
gi|1657758 (U66707) densin-180 [Rattus norvegicus]                     34  1.2
gi|3335351 (AC004512) Similar to ERECTA receptor protein kinase ...    34  1.6
gi|1504040|dbj|BAA13219| (D86983) similar to D.melanogaster pero...    33  2.7
gi|3252977 (AF068919) Ras-binding protein SUR-8 [Caenorhabditis ...    33  2.7
gi|1345878|sp|P49606|CYAA_USTMA ADENYLATE CYCLASE (ATP PYROPHOSP...    33  2.7
gi|1401355 (U61957) contains similarity to leucine-rich repeats ...    33  2.7
gi|4092771 (AF105139) disease resistance gene homolog 1A [Brassi...    32  3.5
gi|1361985|pir||A57072 disease resistance protein RPM1 - Arabido...    32  3.5
gi|3056600 (AC004255) T1F9.21 [Arabidopsis thaliana]                   32  4.6
gi|548879|sp|Q01730|RSU1_MOUSE RAS SUPPRESSOR PROTEIN 1 (RSU-1) ...    32  4.6
gi|2213599 (AC000348) T7N9.19 [Arabidopsis thaliana]                   32  4.6
gi|3461839 (AC005315) putative receptor protein kinase [Arabidop...    32  4.6
gi|4455310|emb|CAB36845| (AL035528) putative disease resistance ...    32  4.6
gi|3894389 (AF053996) Hcr2-2A [Lycopersicon pimpinellifolium]          32  6.0
gi|3894385 (AF053994) Hcr2-0A [Lycopersicon esculentum]                31  7.9
gi|4049897 (AF063866) ORF MSV010 leucine rich repeat gene family...    31  7.9
gi|1469876|dbj|BAA09768| (D63481) The KIAA0147 gene product is r...    31  7.9
gi|2781362 (AC003113) F24O1.18 [Arabidopsis thaliana]                  31  7.9


>gi|4239895|dbj|BAA74737| (AB016816) MASL1 [Homo sapiens] Length = 1052 Score = 41.0 bits (94), Expect = 0.009 Identities = 24/52 (46%), Positives = 32/52 (61%) Query: 156 GIETGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKNEF 1 G E G LP FCE+++L+ L L N L LP++F L+ LK+LNL N F Sbjct: 236 GAELG--TLPAGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNLSSNLF 285
>gi|480379|pir||S36779 ribosome-binding protein p34 - rat >gi|534876|dbj|BAA02786| (D13623) p34 protein [Rattus sp.] Length = 307 Score = 37.5 bits (85), Expect = 0.11 Identities = 20/43 (46%), Positives = 26/43 (59%) Query: 135 KLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKN 7 +LP F + NL+HL L+N L LP F LK+LK L+L N Sbjct: 76 QLPADFGRLVNLQHLDLLNNRLVTLPVSFAQLKNLKWLDLKDN 118
>gi|2459628 (U88880) Toll-like receptor 4 [Homo sapiens] >gi|4507533|ref|NP_003257.1|pTLR4| toll-like receptor4 Length = 799 Score = 36.7 bits (83), Expect = 0.18 Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Query: 138 NKLPKIFCEISNLKHLTLMNLNLYKL-PSRFENLKDLKILNLVKNEF 1 N LP IF E+ NL L L L +L P+ F +L L++LN+ N F Sbjct: 446 NFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNF 492
>gi|2429103 (U93091) Toll protein homolog [Homo sapiens] Length = 839 Score = 36.7 bits (83), Expect = 0.18 Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Query: 138 NKLPKIFCEISNLKHLTLMNLNLYKL-PSRFENLKDLKILNLVKNEF 1 N LP IF E+ NL L L L +L P+ F +L L++LN+ N F Sbjct: 486 NFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNF 532
>gi|117793|sp|P23466|CYAA_SACKL ADENYLATE CYCLASE (ATP PYROPHOSPHATE-LYASE) (ADENYLYL CYCLASE) >gi|68375|pir||OYBYK adenylate cyclase (EC 4.6.1.1) - yeast (Saccharomyces kluyveri) >gi|233345|bbs|47635 adenylyl cyclase, CYR [Saccharomyces kluyveri, Peptide, 1839 aa] >gi|4857|emb|CAA39513| (X56042) adenylyl cyclase [Saccharomyces kluyveri] Length = 1839 Score = 35.2 bits (79), Expect = 0.53 Identities = 19/46 (41%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Query: 138 NKLPKIFCEISNLKHLTLMNL---NLYKLPSRFENLKDLKILNLVKNEF 1 N + K+ I L +LT++NL NL +LP F LK+L++L++ N+F Sbjct: 690 NFIKKVPDSIFKLNNLTIVNLQCNNLERLPPGFSKLKNLQLLDISSNKF 738
>gi|4092774 (AF105140) disease resistance gene homolog 9N [Brassica napus] Length = 926 Score = 35.2 bits (79), Expect = 0.53 Identities = 17/43 (39%), Positives = 26/43 (59%) Query: 147 TGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILN 19 +G +KLP+I + NLK+L L + +LP F L +L+ LN Sbjct: 591 SGISKLPEILVTLFNLKYLNLSKTEVKELPRDFHRLINLETLN 633
>gi|3877646|emb|CAB05742| (Z83230) similar to Leucine Rich Repeat (2 copies) (2 domains); cDNA EST yk417h6.5 comes from this gene; cDNA EST yk486h1.5 comes from this gene [Caenorhabditis elegans] Length = 230 Score = 34.8 bits (78), Expect = 0.70 Identities = 17/35 (48%), Positives = 23/35 (65%) Query: 111 ISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKN 7 +++L+HL L N + LP F NLK LK L+L KN Sbjct: 83 LTSLQHLNLYNNQIEDLPLSFANLKSLKWLDLKKN 117
>gi|3845236 (AE001407) T-complex protein 1 (HSP60 fold superfamily) [Plasmodium falciparum] Length = 540 Score = 34.8 bits (78), Expect = 0.70 Identities = 20/64 (31%), Positives = 35/64 (54%) Query: 207 KYLENYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLK 28 KY++N+KK V +I G + + + FC+ +N+ L K+ S+FE L+ K Sbjct: 275 KYIDNFKKANVDVIIVNG---AISDIAQHFCDTNNIMTL--------KITSKFETLRICK 323 Query: 27 ILNL 16 +LN+ Sbjct: 324 LLNI 327
>gi|171360 (M12057) adenylate cyclase [Saccharomyces cerevisiae] Length = 2026 Score = 34.8 bits (78), Expect = 0.70 Identities = 18/45 (40%), Positives = 27/45 (60%) Query: 135 KLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKNEF 1 K+P ++SNL L L L LP+ F LK+L++L+L N+F Sbjct: 877 KVPNSIMKLSNLTILNLQCNELESLPAGFVELKNLQLLDLSSNKF 921
>gi|854568|emb|CAA60917| (X87611) adenylate cyclase [Saccharomyces cerevisiae] Length = 1354 Score = 34.8 bits (78), Expect = 0.70 Identities = 18/45 (40%), Positives = 27/45 (60%) Query: 135 KLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKNEF 1 K+P ++SNL L L L LP+ F LK+L++L+L N+F Sbjct: 205 KVPNSIMKLSNLTILNLQCNELESLPAGFVELKNLQLLDLSSNKF 249
>gi|1169151|sp|P08678|CYAA_YEAST ADENYLATE CYCLASE (ATP PYROPHOSPHATE-LYASE) (ADENYLYL CYCLASE) >gi|1070522|pir||OYBY adenylate cyclase (EC 4.6.1.1) - yeast (Saccharomyces cerevisiae) >gi|1006714|emb|CAA89295| (Z49280) ORF YJL005w [Saccharomyces cerevisiae] Length = 2026 Score = 34.8 bits (78), Expect = 0.70 Identities = 18/45 (40%), Positives = 27/45 (60%) Query: 135 KLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKNEF 1 K+P ++SNL L L L LP+ F LK+L++L+L N+F Sbjct: 877 KVPNSIMKLSNLTILNLQCNELESLPAGFVELKNLQLLDLSSNKF 921
>gi|2498866|sp|Q15404|RSU1_HUMAN RAS SUPPRESSOR PROTEIN 1 (RSU-1) (RSP-1 PROTEIN) (RSP-1) >gi|2135399|pir||I60122 homologous to mouse Rsu-1 - human >gi|434051 (L12535) homologous to mouse Rsu-1; putative [Homo sapiens] Length = 277 Score = 34.4 bits (77), Expect = 0.91 Identities = 22/61 (36%), Positives = 30/61 (49%) Query: 189 KKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVK 10 K ++V N N IE +LP + LKHL L L LP F +L L++L+L Sbjct: 63 KNLEVLNFFNNQIE----ELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTY 118 Query: 9 N 7 N Sbjct: 119 N 119 Score = 31.3 bits (69), Expect = 7.9 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Query: 141 YNKL---PKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKN 7 +NKL P E+ NL+ L N + +LP++ +L+ LK LNL N Sbjct: 49 HNKLTMVPPNIAELKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMN 96
>gi|3168891 (AF068716) contains similarity to repeated leucine-rich (LRRa) domains [Caenorhabditis elegans] Length = 717 Score = 34.4 bits (77), Expect = 0.91 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Query: 153 IETGYNKLPKIFCEISNLKHLTLMNLN---LYKLPSRFENLKDLKILNLVKNEF 1 ++ N+L + EI NL L +NLN + KLP +N K L LNL N F Sbjct: 64 LDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPF 117 Score = 33.6 bits (75), Expect = 1.6 Identities = 21/79 (26%), Positives = 40/79 (50%) Query: 243 IIQLFLCSFTLYKYLENYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYK 64 +I+L L ++ K + + K+ +N + +LP+ CE S++ L+L +L Sbjct: 84 LIELNLNRNSIAKLPDTMQNCKLLTTLNLS-SNPFTRLPETICECSSITILSLNETSLTL 142 Query: 63 LPSRFENLKDLKILNLVKN 7 LPS +L +L++L N Sbjct: 143 LPSNIGSLTNLRVLEARDN 161
>gi|3132526 (AF051151) Toll/interleukin-1 receptor-like protein 3 [Homo sapiens] Length = 858 Score = 34.0 bits (76), Expect = 1.2 Identities = 18/35 (51%), Positives = 26/35 (73%), Gaps = 1/35 (2%) Query: 108 SNLKHLTLMNLNLYKLPSR-FENLKDLKILNLVKNE 4 S+++HL L + ++ L SR FE LKDLK+LNL N+ Sbjct: 288 SSVRHLDLSHGFVFSLNSRVFETLKDLKVLNLAYNK 323
>gi|1657758 (U66707) densin-180 [Rattus norvegicus] Length = 1495 Score = 34.0 bits (76), Expect = 1.2 Identities = 23/67 (34%), Positives = 34/67 (50%) Query: 207 KYLENYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLK 28 ++ EN K K +I + +KLP F ++ NL L L + L LP+ F L L+ Sbjct: 111 EFPENIKCCKCLTIIEASVNP-ISKLPDGFTQLLNLTQLYLNDAFLEFLPANFGRLVKLR 169 Query: 27 ILNLVKN 7 IL L +N Sbjct: 170 ILELREN 176 Score = 31.3 bits (69), Expect = 7.9 Identities = 16/45 (35%), Positives = 26/45 (57%) Query: 141 YNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKN 7 +++LP++ +I NL+ L + N L LP LK L L++ KN Sbjct: 201 FSELPEVLDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKN 245
>gi|3335351 (AC004512) Similar to ERECTA receptor protein kinase gb|D83257 from A. thaliana. ESTs gb|T41629 and gb|AA586072 come from this gene. [Arabidopsis thaliana] Length = 720 Score = 33.6 bits (75), Expect = 1.6 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Query: 180 KVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLY-KLPSRFENLKDLKILNLVKNE 4 KV +L G+ P + C++S+L+ L L + N +PS F +L++L+ LNL +N Sbjct: 74 KVLSLTLSGLNLSSQIHPSL-CKLSSLQSLDLSHNNFSGNIGSLRNLRTLNLSRNR 132 Query: 3 F 1 F Sbjct: 133 F 133
>gi|1504040|dbj|BAA13219| (D86983) similar to D.melanogaster peroxidasin(U11052) [Homo sapiens] Length = 1496 Score = 32.8 bits (73), Expect = 2.7 Identities = 19/42 (45%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Query: 129 PKIFCEISNLKHLTLMNLNLYKLPS-RFENLKDLKILNLVKNE 4 P F + NL L L N + ++PS FE+L++LK L L KNE Sbjct: 96 PGAFRRLRNLNTLLLNNNQIKRIPSGAFEDLENLKYLYLYKNE 138
>gi|3252977 (AF068919) Ras-binding protein SUR-8 [Caenorhabditis elegans] >gi|3293318 (AF054827) leucine-rich repeat protein SOC-2 [Caenorhabditis elegans] Length = 559 Score = 32.8 bits (73), Expect = 2.7 Identities = 18/43 (41%), Positives = 27/43 (61%) Query: 132 LPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKNE 4 LP+ ++ NL+ L L N L KLP++ NL L+ L+L +NE Sbjct: 390 LPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENE 432
>gi|1345878|sp|P49606|CYAA_USTMA ADENYLATE CYCLASE (ATP PYROPHOSPHATE-LYASE) (ADENYLYL CYCLASE) >gi|1078670|pir||A55481 adenylate cyclase (EC 4.6.1.1) uac1 - smut fungus (Ustilago maydis) >gi|603940 (L33918) uac1 [Ustilago maydis] Length = 2493 Score = 32.8 bits (73), Expect = 2.7 Identities = 19/72 (26%), Positives = 35/72 (48%) Query: 219 FTLYKYLENYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENL 40 F L Y + ++ N+ N E + PK+ C++ +L L + ++ +LP+ NL Sbjct: 1193 FDLPSYFSSISTLRNLNISNNRFE----EFPKVICDVPSLVDLDVSFNSITELPAEIANL 1248 Query: 39 KDLKILNLVKNE 4 +L+ L NE Sbjct: 1249 INLERFILAGNE 1260
>gi|1401355 (U61957) contains similarity to leucine-rich repeats [Caenorhabditis elegans] Length = 613 Score = 32.8 bits (73), Expect = 2.7 Identities = 18/43 (41%), Positives = 27/43 (61%) Query: 132 LPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKNE 4 LP+ ++ NL+ L L N L KLP++ NL L+ L+L +NE Sbjct: 436 LPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENE 478 Score = 31.3 bits (69), Expect = 7.9 Identities = 24/71 (33%), Positives = 38/71 (52%), Gaps = 4/71 (5%) Query: 216 TLYKYLENYKKIK-VTNLINEGIETGYNK---LPKIFCEISNLKHLTLMNLNLYKLPSRF 49 TL+ ++ ++ + NLI GI+ NK LP ++ NLK L L L LP Sbjct: 120 TLFLFISKPQETSFLENLIISGIKNFQNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSL 179 Query: 48 ENLKDLKILNLVKNE 4 +L+ L+ L+L N+ Sbjct: 180 ASLESLETLDLRHNK 194
>gi|4092771 (AF105139) disease resistance gene homolog 1A [Brassica napus] Length = 927 Score = 32.5 bits (72), Expect = 3.5 Identities = 16/43 (37%), Positives = 23/43 (53%) Query: 147 TGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILN 19 +G KLP + NLK+L L + +LP F L +L+ LN Sbjct: 592 SGVTKLPDFLVTLFNLKYLNLSKTEVKELPRDFHRLINLETLN 634
>gi|1361985|pir||A57072 disease resistance protein RPM1 - Arabidopsis thaliana >gi|963017|emb|CAA61131| (X87851) disease resistance gene [Arabidopsis thaliana] Length = 926 Score = 32.5 bits (72), Expect = 3.5 Identities = 22/72 (30%), Positives = 36/72 (49%), Gaps = 2/72 (2%) Query: 234 LFLCSFTLYKY--LENYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKL 61 L +CS +K L + ++ +L + I +KLP + NLK+L L + +L Sbjct: 564 LLVCSSAKHKMELLPSLNLLRALDLEDSSI----SKLPDCLVTMFNLKYLNLSKTQVKEL 619 Query: 60 PSRFENLKDLKILN 19 P F L +L+ LN Sbjct: 620 PKNFHKLVNLETLN 633
>gi|3056600 (AC004255) T1F9.21 [Arabidopsis thaliana] Length = 766 Score = 32.1 bits (71), Expect = 4.6 Identities = 16/42 (38%), Positives = 25/42 (59%) Query: 141 YNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNL 16 +NKLP+ + +L+ L L N ++ +LP + LK L LNL Sbjct: 459 FNKLPEQISGLVSLQFLDLSNTSIKQLPVGLKKLKKLTFLNL 500
>gi|548879|sp|Q01730|RSU1_MOUSE RAS SUPPRESSOR PROTEIN 1 (RSU-1) (RSP-1 PROTEIN) (RSP-1) >gi|284990|pir||S25770 RSP-1 protein - mouse >gi|54015|emb|CAA44765| (X63039) p33 RSP-1 [Mus musculus] Length = 277 Score = 32.1 bits (71), Expect = 4.6 Identities = 21/61 (34%), Positives = 29/61 (47%) Query: 189 KKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVK 10 K ++V N N IE +LP + LKHL L L LP F + + L++L L Sbjct: 63 KNLEVLNFFNNQIE----ELPTQISSLQKLKHLNLGMNRLNTLPRGFGSSRLLEVLELTY 118 Query: 9 N 7 N Sbjct: 119 N 119
>gi|2213599 (AC000348) T7N9.19 [Arabidopsis thaliana] Length = 1556 Score = 32.1 bits (71), Expect = 4.6 Identities = 18/64 (28%), Positives = 33/64 (51%) Query: 201 LENYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKIL 22 LEN ++++ N +LPK F ++ +L L + + +LP F NL +L +L Sbjct: 1148 LENLVELRMNNC------KMLKRLPKSFGDLKSLHRLYMQETLVAELPESFGNLSNLMVL 1201 Query: 21 NLVK 10 ++K Sbjct: 1202 EMLK 1205
>gi|3461839 (AC005315) putative receptor protein kinase [Arabidopsis thaliana] Length = 786 Score = 32.1 bits (71), Expect = 4.6 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Query: 186 KIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKL-PSRFENLKDLKILNLVK 10 KI NL G+ TG LP +F ++ ++ L L N +L L PS N+K L +L+L Sbjct: 309 KIISLNLSASGL-TG--SLPSVFQNLTQIQELDLSNNSLTGLVPSFLANIKSLSLLDLSG 365 Query: 9 NEF 1 N F Sbjct: 366 NNF 368
>gi|4455310|emb|CAB36845| (AL035528) putative disease resistance protein [Arabidopsis thaliana] Length = 741 Score = 32.1 bits (71), Expect = 4.6 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Query: 135 KLPKIFCEISNLKHLTLMNLNLY-KLPSRFENLKDLKILNLVKN 7 ++PK CE+ NL+ L L N N +P FENL L +L+L N Sbjct: 363 EIPKTICELDNLRILVLSNNNFSGSIPRCFENL-HLYVLHLRNN 405 Score = 31.3 bits (69), Expect = 7.9 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Query: 132 LPKIFCEISNLKHLTLMNLNLY-KLPSRFENLKDLKILNLVKNEF 1 LP + LK L L+N NL+ K+PS NL L L+L N+F Sbjct: 66 LPDSIGNLKRLKVLVLVNCNLFGKIPSSLGNLSYLTHLDLSYNDF 110
>gi|3894389 (AF053996) Hcr2-2A [Lycopersicon pimpinellifolium] Length = 802 Score = 31.7 bits (70), Expect = 6.0 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Query: 195 NYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLY-KLPSRFENLKDLKILN 19 N +K+ L ++ K+P+ IS L+ LT+ NL ++PS NL+ L+IL+ Sbjct: 357 NLTSLKILYLRRNNLK---GKVPQCLGNISGLQVLTMSPNNLSGEIPSSISNLRSLQILD 413 Query: 18 LVKN 7 L +N Sbjct: 414 LGRN 417
>gi|3894385 (AF053994) Hcr2-0A [Lycopersicon esculentum] Length = 826 Score = 31.3 bits (69), Expect = 7.9 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Query: 195 NYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYK-LPSRFENLKDLKILN 19 N +K+ L ++ K+P+ IS L+ LT+ NL +PS NL+ L+IL+ Sbjct: 381 NLTSLKILYLRRNNLK---GKVPQCLGNISGLQVLTMSRNNLSGVIPSSISNLRSLQILD 437 Query: 18 LVKN 7 L +N Sbjct: 438 LGRN 441
>gi|4049897 (AF063866) ORF MSV010 leucine rich repeat gene family protein, similar to Amsacta moorei entomopoxvirus Q3 ORF SW:P28854 [Melanoplus sanguinipes entomopoxvirus] Length = 611 Score = 31.3 bits (69), Expect = 7.9 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 8/81 (9%) Query: 249 LVIIQLFLCSFTLYKYLENYKKIKVTNLI-NEGIETGYNKLPK-------IFCEISNLKH 94 L+ + +C+ T +K+LE ++ N+ N KLP ++C IS+ K Sbjct: 477 LIELDCTICNITDFKFLEPLINLQKLNICGNHDSNISICKLPLSLIELNCMYCYISDFKF 536 Query: 93 LTLMNLNLYKLPSRFENLKDLKILNLVKN 7 L E LK LKILN+ KN Sbjct: 537 L--------------EPLKSLKILNICKN 551
>gi|1469876|dbj|BAA09768| (D63481) The KIAA0147 gene product is related to adenylyl cyclase. [Homo sapiens] Length = 1551 Score = 31.3 bits (69), Expect = 7.9 Identities = 16/44 (36%), Positives = 26/44 (58%) Query: 138 NKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKN 7 ++LP F ++ +L HL L +++L LP NL +L L L +N Sbjct: 52 SRLPDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELREN 95
>gi|2781362 (AC003113) F24O1.18 [Arabidopsis thaliana] Length = 786 Score = 31.3 bits (69), Expect = 7.9 Identities = 19/55 (34%), Positives = 33/55 (59%), Gaps = 4/55 (7%) Query: 165 INEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKL----PSRFENLKDLKILNLVKNEF 1 +NE I + N + +I NLK++T+ +++ +L PS N+K L+ LN+ N F Sbjct: 246 LNEIILSNDNLTGCLPPQIGNLKNVTVFDISFNRLSGPLPSSIGNMKSLEQLNVANNRF 304 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 12, 1999 12:54 PM Number of letters in database: 112,640,273 Number of sequences in database: 368,476 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 102378749 Number of Sequences: 368476 Number of extensions: 1636892 Number of successful extensions: 4735 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 22 Number of HSP's that attempted gapping in prelim test: 4663 Number of HSP's gapped (non-prelim): 98 length of query: 256 length of database: 112640273 effective HSP length: 54 effective length of query: 201 effective length of database: 92742569 effective search space: 18641256369 effective search space used: 18641256369 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 68 (30.9 bits)