BLASTX 2.0.8 [Jan-05-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 11VII-25F (491 letters) Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR 369,800 sequences; 113,023,754 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|2829877 (AC002396) Hypothetical protein [Arabidopsis thaliana] 34 0.67 gi|2688596 (AE001167) B. burgdorferi predicted coding region BB0... 31 4.4
>gi|2829877 (AC002396) Hypothetical protein [Arabidopsis thaliana] Length = 252 Score = 34.0 bits (76), Expect = 0.67 Identities = 22/74 (29%), Positives = 35/74 (46%), Gaps = 4/74 (5%) Query: 215 TNYNILKDTIFNGTKLQYGEVLEILYQFSCRRT----VADSAETLGHSKTTIMSFYKLFR 382 T+Y I F+ +YGE+L++L F RR V E L ++ + +F Sbjct: 122 TSYLIAVKEAFHDEPAKYGEMLKLLKDFKARRVDAACVIARVEELMKDHLNLLFGFCVFL 181 Query: 383 ASLTYFLEKTSEKLGGDG 436 ++ T F K + GDG Sbjct: 182 SATTSFTTKLKARFQGDG 199
>gi|2688596 (AE001167) B. burgdorferi predicted coding region BB0662 [Borrelia burgdorferi] Length = 136 Score = 31.3 bits (69), Expect = 4.4 Identities = 21/71 (29%), Positives = 36/71 (50%) Query: 197 GDSQNKTNYNILKDTIFNGTKLQYGEVLEILYQFSCRRTVADSAETLGHSKTTIMSFYKL 376 G S + N+LK TIF Y +V E+ + ++ ++T+ A+T H K + +F K Sbjct: 18 GSSMDSVKENVLKSTIF------YYDVEEVEFPYARKQTLQFIAKT--HLKYAVFNFDKN 69 Query: 377 FRASLTYFLEK 409 S T+ +K Sbjct: 70 KMFSYTFVFDK 80 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 17, 1999 5:33 AM Number of letters in database: 113,023,754 Number of sequences in database: 369,800 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89075839 Number of Sequences: 369800 Number of extensions: 1582439 Number of successful extensions: 3361 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 3361 Number of HSP's gapped (non-prelim): 2 length of query: 163 length of database: 113023754 effective HSP length: 52 effective length of query: 111 effective length of database: 93794154 effective search space: 10411151094 effective search space used: 10411151094 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 66 (30.1 bits)