BLASTX 2.0.8 [Jan-05-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 11VII-1F (825 letters) Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR 368,476 sequences; 112,640,273 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value gi|2459628 (U88880) Toll-like receptor 4 [Homo sapiens] >gi|4507... 42 0.006 gi|2429103 (U93091) Toll protein homolog [Homo sapiens] 42 0.006 gi|4239895|dbj|BAA74737| (AB016816) MASL1 [Homo sapiens] 41 0.010 gi|4049771 (AF063866) ORF MSV255 leucine rich repeat gene family... 38 0.11 gi|480379|pir||S36779 ribosome-binding protein p34 - rat >gi|534... 38 0.11 gi|4049759 (AF063866) ORF MSV240 leucine rich repeat gene family... 35 0.58 gi|117793|sp|P23466|CYAA_SACKL ADENYLATE CYCLASE (ATP PYROPHOSPH... 35 0.58 gi|4092774 (AF105140) disease resistance gene homolog 9N [Brassi... 35 0.58 gi|3877646|emb|CAB05742| (Z83230) similar to Leucine Rich Repeat... 35 0.76 gi|1169151|sp|P08678|CYAA_YEAST ADENYLATE CYCLASE (ATP PYROPHOSP... 35 0.76 gi|171360 (M12057) adenylate cyclase [Saccharomyces cerevisiae] 35 0.76 gi|854568|emb|CAA60917| (X87611) adenylate cyclase [Saccharomyce... 35 0.76 gi|3168891 (AF068716) contains similarity to repeated leucine-ri... 34 1.00 gi|2498866|sp|Q15404|RSU1_HUMAN RAS SUPPRESSOR PROTEIN 1 (RSU-1)... 34 1.00 gi|3056600 (AC004255) T1F9.21 [Arabidopsis thaliana] 34 1.3 gi|3132526 (AF051151) Toll/interleukin-1 receptor-like protein 3... 34 1.3 gi|1657758 (U66707) densin-180 [Rattus norvegicus] 34 1.7 gi|3335351 (AC004512) Similar to ERECTA receptor protein kinase ... 34 1.7 gi|1708880|sp|P51886|LUM_RAT LUMICAN PRECURSOR (LUM) (KERATAN SU... 33 2.2 gi|1401355 (U61957) contains similarity to leucine-rich repeats ... 33 2.9 gi|1504040|dbj|BAA13219| (D86983) similar to D.melanogaster pero... 33 2.9 gi|3287742|sp|Q58692|BIOB_METJA BIOTIN SYNTHASE (BIOTIN SYNTHETA... 33 2.9 gi|3252977 (AF068919) Ras-binding protein SUR-8 [Caenorhabditis ... 33 2.9 gi|3845225 (AE001405) hypothetical protein [Plasmodium falciparum] 32 3.8 gi|4092771 (AF105139) disease resistance gene homolog 1A [Brassi... 32 3.8 gi|3845236 (AE001407) T-complex protein 1 (HSP60 fold superfamil... 32 3.8 gi|1361985|pir||A57072 disease resistance protein RPM1 - Arabido... 32 3.8 gi|3649772|emb|CAB11121| (Z98547) predicted using hexExon; MAL3P... 32 3.8 gi|3461839 (AC005315) putative receptor protein kinase [Arabidop... 32 5.0 gi|4455310|emb|CAB36845| (AL035528) putative disease resistance ... 32 5.0 gi|3649753|emb|CAB11102| (Z98547) predicted using hexExon; MAL3P... 32 5.0 gi|548879|sp|Q01730|RSU1_MOUSE RAS SUPPRESSOR PROTEIN 1 (RSU-1) ... 32 5.0 gi|2213599 (AC000348) T7N9.19 [Arabidopsis thaliana] 32 6.6 gi|4049911 (AF063866) ORF MSV227 leucine rich repeat gene family... 32 6.6 gi|3894389 (AF053996) Hcr2-2A [Lycopersicon pimpinellifolium] 32 6.6 gi|3845160 (AE001388) SERA antigen/papain-like protease with act... 32 6.6 gi|3377849 (AF076274) similar to receptor protein kinases [Arabi... 32 6.6 gi|2781362 (AC003113) F24O1.18 [Arabidopsis thaliana] 31 8.6 gi|3875045|emb|CAA99797| (Z75530) C47E8.2 [Caenorhabditis elegan... 31 8.6 gi|1345878|sp|P49606|CYAA_USTMA ADENYLATE CYCLASE (ATP PYROPHOSP... 31 8.6 gi|1350783|sp|P47735|RLK5_ARATH RECEPTOR-LIKE PROTEIN KINASE 5 P... 31 8.6 gi|4115383 (AC005967) receptor-like protein kinase [Arabidopsis ... 31 8.6 gi|1469876|dbj|BAA09768| (D63481) The KIAA0147 gene product is r... 31 8.6 gi|3894385 (AF053994) Hcr2-0A [Lycopersicon esculentum] 31 8.6
>gi|2459628 (U88880) Toll-like receptor 4 [Homo sapiens] >gi|4507533|ref|NP_003257.1|pTLR4| toll-like receptor4 Length = 799 Score = 41.8 bits (96), Expect = 0.006 Identities = 34/136 (25%), Positives = 64/136 (47%), Gaps = 2/136 (1%) Query: 408 TIQYSQLLMNXLLVIFLRLITCTNYKITSDDYDSLHDLIIYSDDVYL-NELYNEISNNST 232 +++Y L N ++ + + + + +L + +S + L N +Y +IS+ T Sbjct: 360 SLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHT 419 Query: 231 XLCSFTLYKFLKNYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKL-PS 55 + ++ L + + +K+ G N LP IF E+ NL L L L +L P+ Sbjct: 420 RVAFNGIFNGLSSLEVLKMA-----GNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPT 474 Query: 54 RFENLKDLKILNLVKNEF 1 F +L L++LN+ N F Sbjct: 475 AFNSLSSLQVLNMSHNNF 492
>gi|2429103 (U93091) Toll protein homolog [Homo sapiens] Length = 839 Score = 41.8 bits (96), Expect = 0.006 Identities = 34/136 (25%), Positives = 64/136 (47%), Gaps = 2/136 (1%) Query: 408 TIQYSQLLMNXLLVIFLRLITCTNYKITSDDYDSLHDLIIYSDDVYL-NELYNEISNNST 232 +++Y L N ++ + + + + +L + +S + L N +Y +IS+ T Sbjct: 400 SLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHT 459 Query: 231 XLCSFTLYKFLKNYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKL-PS 55 + ++ L + + +K+ G N LP IF E+ NL L L L +L P+ Sbjct: 460 RVAFNGIFNGLSSLEVLKMA-----GNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPT 514 Query: 54 RFENLKDLKILNLVKNEF 1 F +L L++LN+ N F Sbjct: 515 AFNSLSSLQVLNMSHNNF 532
>gi|4239895|dbj|BAA74737| (AB016816) MASL1 [Homo sapiens] Length = 1052 Score = 41.0 bits (94), Expect = 0.010 Identities = 24/52 (46%), Positives = 32/52 (61%) Query: 156 GIETGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKNEF 1 G E G LP FCE+++L+ L L N L LP++F L+ LK+LNL N F Sbjct: 236 GAELG--TLPAGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNLSSNLF 285
>gi|4049771 (AF063866) ORF MSV255 leucine rich repeat gene family protein, similar to Amsacta moorei entomopoxvirus Q3 ORF SW:P28854 [Melanoplus sanguinipes entomopoxvirus] Length = 403 Score = 37.5 bits (85), Expect = 0.11 Identities = 32/119 (26%), Positives = 63/119 (52%), Gaps = 13/119 (10%) Query: 363 FLRLITCTNYKITSDDYDSLH---DLIIYSDD----VYLNELYNEISNNSTXLCSFTLYK 205 +++ + CTN I + + L +++I SD+ + L +L N+I C+ +K Sbjct: 20 YIKFLDCTNRNIKNFKFLELLTNLEILIISDNPDSNISLCKLPNKIKRFECNYCNIKDFK 79 Query: 204 FLKNYKKIKVTNLINEGIETGY------NKLPKIFCEISNLKHLTLMNLNLYKLPSRFEN 43 FL+ + +++ + I+E + NKL KI C N+K + E Sbjct: 80 FLEPLENLEILD-ISENYNSNISLCKLSNKLKKIICNYCNIKDFKFL-----------EP 127 Query: 42 LKDLKILNLVKN 7 L++L+IL++ +N Sbjct: 128 LENLEILDISEN 139
>gi|480379|pir||S36779 ribosome-binding protein p34 - rat >gi|534876|dbj|BAA02786| (D13623) p34 protein [Rattus sp.] Length = 307 Score = 37.5 bits (85), Expect = 0.11 Identities = 20/43 (46%), Positives = 26/43 (59%) Query: 135 KLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKN 7 +LP F + NL+HL L+N L LP F LK+LK L+L N Sbjct: 76 QLPADFGRLVNLQHLDLLNNRLVTLPVSFAQLKNLKWLDLKDN 118
>gi|4049759 (AF063866) ORF MSV240 leucine rich repeat gene family protein, similar to Amsacta moorei entomopoxvirus Q3 ORF SW:P28854 [Melanoplus sanguinipes entomopoxvirus] Length = 527 Score = 35.2 bits (79), Expect = 0.58 Identities = 35/104 (33%), Positives = 52/104 (49%), Gaps = 16/104 (15%) Query: 318 DYDSLHDLIIYSDDVYLNEL--YNEISNNSTXLCSFTLYKFLKNYKKIKVTNLINEGIET 145 D+ S LI Y D +N+L E N + L T+YK++ Y +++TNL Sbjct: 7 DFYSYKTLIEYLDINNINKLSIIEECRNYNLELNIITIYKYIDFYNPLEITNL------- 59 Query: 144 GYNKLPKIFCE----ISNLKHLTLM---NLNLYKLPSRFE-------NLKDLKILNLVKN 7 +K I C + NL+ L + NLN LP + N+KD K L + N Sbjct: 60 DCHKCNIIDCNFLKPLENLEELNISENNNLNKLLLPKSIKKLNCNNCNIKDFKFLEPLDN 119
>gi|117793|sp|P23466|CYAA_SACKL ADENYLATE CYCLASE (ATP PYROPHOSPHATE-LYASE) (ADENYLYL CYCLASE) >gi|68375|pir||OYBYK adenylate cyclase (EC 4.6.1.1) - yeast (Saccharomyces kluyveri) >gi|233345|bbs|47635 adenylyl cyclase, CYR [Saccharomyces kluyveri, Peptide, 1839 aa] >gi|4857|emb|CAA39513| (X56042) adenylyl cyclase [Saccharomyces kluyveri] Length = 1839 Score = 35.2 bits (79), Expect = 0.58 Identities = 19/46 (41%), Positives = 31/46 (67%), Gaps = 3/46 (6%) Query: 138 NKLPKIFCEISNLKHLTLMNL---NLYKLPSRFENLKDLKILNLVKNEF 1 N + K+ I L +LT++NL NL +LP F LK+L++L++ N+F Sbjct: 690 NFIKKVPDSIFKLNNLTIVNLQCNNLERLPPGFSKLKNLQLLDISSNKF 738
>gi|4092774 (AF105140) disease resistance gene homolog 9N [Brassica napus] Length = 926 Score = 35.2 bits (79), Expect = 0.58 Identities = 17/43 (39%), Positives = 26/43 (59%) Query: 147 TGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILN 19 +G +KLP+I + NLK+L L + +LP F L +L+ LN Sbjct: 591 SGISKLPEILVTLFNLKYLNLSKTEVKELPRDFHRLINLETLN 633
>gi|3877646|emb|CAB05742| (Z83230) similar to Leucine Rich Repeat (2 copies) (2 domains); cDNA EST yk417h6.5 comes from this gene; cDNA EST yk486h1.5 comes from this gene [Caenorhabditis elegans] Length = 230 Score = 34.8 bits (78), Expect = 0.76 Identities = 17/35 (48%), Positives = 23/35 (65%) Query: 111 ISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKN 7 +++L+HL L N + LP F NLK LK L+L KN Sbjct: 83 LTSLQHLNLYNNQIEDLPLSFANLKSLKWLDLKKN 117
>gi|1169151|sp|P08678|CYAA_YEAST ADENYLATE CYCLASE (ATP PYROPHOSPHATE-LYASE) (ADENYLYL CYCLASE) >gi|1070522|pir||OYBY adenylate cyclase (EC 4.6.1.1) - yeast (Saccharomyces cerevisiae) >gi|1006714|emb|CAA89295| (Z49280) ORF YJL005w [Saccharomyces cerevisiae] Length = 2026 Score = 34.8 bits (78), Expect = 0.76 Identities = 18/45 (40%), Positives = 27/45 (60%) Query: 135 KLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKNEF 1 K+P ++SNL L L L LP+ F LK+L++L+L N+F Sbjct: 877 KVPNSIMKLSNLTILNLQCNELESLPAGFVELKNLQLLDLSSNKF 921
>gi|171360 (M12057) adenylate cyclase [Saccharomyces cerevisiae] Length = 2026 Score = 34.8 bits (78), Expect = 0.76 Identities = 18/45 (40%), Positives = 27/45 (60%) Query: 135 KLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKNEF 1 K+P ++SNL L L L LP+ F LK+L++L+L N+F Sbjct: 877 KVPNSIMKLSNLTILNLQCNELESLPAGFVELKNLQLLDLSSNKF 921
>gi|854568|emb|CAA60917| (X87611) adenylate cyclase [Saccharomyces cerevisiae] Length = 1354 Score = 34.8 bits (78), Expect = 0.76 Identities = 18/45 (40%), Positives = 27/45 (60%) Query: 135 KLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKNEF 1 K+P ++SNL L L L LP+ F LK+L++L+L N+F Sbjct: 205 KVPNSIMKLSNLTILNLQCNELESLPAGFVELKNLQLLDLSSNKF 249
>gi|3168891 (AF068716) contains similarity to repeated leucine-rich (LRRa) domains [Caenorhabditis elegans] Length = 717 Score = 34.4 bits (77), Expect = 1.00 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Query: 153 IETGYNKLPKIFCEISNLKHLTLMNLN---LYKLPSRFENLKDLKILNLVKNEF 1 ++ N+L + EI NL L +NLN + KLP +N K L LNL N F Sbjct: 64 LDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPF 117 Score = 32.8 bits (73), Expect = 2.9 Identities = 19/65 (29%), Positives = 34/65 (52%) Query: 201 LKNYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKIL 22 ++N K + NL + + +LP+ CE S++ L+L +L LPS +L +L++L Sbjct: 101 MQNCKLLTTLNLSSNP----FTRLPETICECSSITILSLNETSLTLLPSNIGSLTNLRVL 156 Query: 21 NLVKN 7 N Sbjct: 157 EARDN 161
>gi|2498866|sp|Q15404|RSU1_HUMAN RAS SUPPRESSOR PROTEIN 1 (RSU-1) (RSP-1 PROTEIN) (RSP-1) >gi|2135399|pir||I60122 homologous to mouse Rsu-1 - human >gi|434051 (L12535) homologous to mouse Rsu-1; putative [Homo sapiens] Length = 277 Score = 34.4 bits (77), Expect = 1.00 Identities = 22/61 (36%), Positives = 30/61 (49%) Query: 189 KKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVK 10 K ++V N N IE +LP + LKHL L L LP F +L L++L+L Sbjct: 63 KNLEVLNFFNNQIE----ELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTY 118 Query: 9 N 7 N Sbjct: 119 N 119 Score = 31.3 bits (69), Expect = 8.6 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Query: 141 YNKL---PKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKN 7 +NKL P E+ NL+ L N + +LP++ +L+ LK LNL N Sbjct: 49 HNKLTMVPPNIAELKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMN 96
>gi|3056600 (AC004255) T1F9.21 [Arabidopsis thaliana] Length = 766 Score = 34.0 bits (76), Expect = 1.3 Identities = 20/64 (31%), Positives = 35/64 (54%) Query: 207 KFLKNYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLK 28 +F++ +K+ V +L +NKLP+ + +L+ L L N ++ +LP + LK L Sbjct: 440 EFIRYMQKLVVLDL---SYNRDFNKLPEQISGLVSLQFLDLSNTSIKQLPVGLKKLKKLT 496 Query: 27 ILNL 16 LNL Sbjct: 497 FLNL 500
>gi|3132526 (AF051151) Toll/interleukin-1 receptor-like protein 3 [Homo sapiens] Length = 858 Score = 34.0 bits (76), Expect = 1.3 Identities = 18/35 (51%), Positives = 26/35 (73%), Gaps = 1/35 (2%) Query: 108 SNLKHLTLMNLNLYKLPSR-FENLKDLKILNLVKNE 4 S+++HL L + ++ L SR FE LKDLK+LNL N+ Sbjct: 288 SSVRHLDLSHGFVFSLNSRVFETLKDLKVLNLAYNK 323
>gi|1657758 (U66707) densin-180 [Rattus norvegicus] Length = 1495 Score = 33.6 bits (75), Expect = 1.7 Identities = 23/67 (34%), Positives = 34/67 (50%) Query: 207 KFLKNYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLK 28 +F +N K K +I + +KLP F ++ NL L L + L LP+ F L L+ Sbjct: 111 EFPENIKCCKCLTIIEASVNP-ISKLPDGFTQLLNLTQLYLNDAFLEFLPANFGRLVKLR 169 Query: 27 ILNLVKN 7 IL L +N Sbjct: 170 ILELREN 176 Score = 32.5 bits (72), Expect = 3.8 Identities = 27/90 (30%), Positives = 47/90 (52%), Gaps = 8/90 (8%) Query: 276 VYLNELYNE-ISNNSTXLCSFTLYKFLKNYKKIKVTNLIN----EGIETGYNK---LPKI 121 +YLN+ + E + N L + + +N+ K ++ E ++ G N+ LP++ Sbjct: 148 LYLNDAFLEFLPANFGRLVKLRILELRENHLKTLPKSMHKLAQLERLDLGNNEFSELPEV 207 Query: 120 FCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKN 7 +I NL+ L + N L LP LK L L++ KN Sbjct: 208 LDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKN 245
>gi|3335351 (AC004512) Similar to ERECTA receptor protein kinase gb|D83257 from A. thaliana. ESTs gb|T41629 and gb|AA586072 come from this gene. [Arabidopsis thaliana] Length = 720 Score = 33.6 bits (75), Expect = 1.7 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Query: 180 KVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLY-KLPSRFENLKDLKILNLVKNE 4 KV +L G+ P + C++S+L+ L L + N +PS F +L++L+ LNL +N Sbjct: 74 KVLSLTLSGLNLSSQIHPSL-CKLSSLQSLDLSHNNFSGNIGSLRNLRTLNLSRNR 132 Query: 3 F 1 F Sbjct: 133 F 133
>gi|1708880|sp|P51886|LUM_RAT LUMICAN PRECURSOR (LUM) (KERATAN SULFATE PROTEOGLYCAN) >gi|1083708|pir||S52284 lumicon, secretory intersticial proteoglycan precursor - rat >gi|643024|emb|CAA58858| (X84039) lumican, secretory intersticial proteoglycan [Rattus norvegicus] Length = 338 Score = 33.2 bits (74), Expect = 2.2 Identities = 26/63 (41%), Positives = 39/63 (61%), Gaps = 16/63 (25%) Query: 273 YLNELYNEISNNSTXLCSFTLYKFLK---NYKKIKVTNLINEGIETGY---NKLPKI--- 121 YL +NE++++ SF + L+ +Y K+K +NE +E Y NKL K Sbjct: 233 YLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNKLEKFDVK 292 Query: 120 -FCEI------SNLKHLTL 85 FC+I S +KHL L Sbjct: 293 SFCKILGPLSYSKIKHLRL 311
>gi|1401355 (U61957) contains similarity to leucine-rich repeats [Caenorhabditis elegans] Length = 613 Score = 32.8 bits (73), Expect = 2.9 Identities = 18/43 (41%), Positives = 27/43 (61%) Query: 132 LPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKNE 4 LP+ ++ NL+ L L N L KLP++ NL L+ L+L +NE Sbjct: 436 LPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENE 478 Score = 32.5 bits (72), Expect = 3.8 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 4/71 (5%) Query: 216 TLYKFLKNYKKIK-VTNLINEGIETGYNK---LPKIFCEISNLKHLTLMNLNLYKLPSRF 49 TL+ F+ ++ + NLI GI+ NK LP ++ NLK L L L LP Sbjct: 120 TLFLFISKPQETSFLENLIISGIKNFQNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSL 179 Query: 48 ENLKDLKILNLVKNE 4 +L+ L+ L+L N+ Sbjct: 180 ASLESLETLDLRHNK 194
>gi|1504040|dbj|BAA13219| (D86983) similar to D.melanogaster peroxidasin(U11052) [Homo sapiens] Length = 1496 Score = 32.8 bits (73), Expect = 2.9 Identities = 19/42 (45%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Query: 129 PKIFCEISNLKHLTLMNLNLYKLPS-RFENLKDLKILNLVKNE 4 P F + NL L L N + ++PS FE+L++LK L L KNE Sbjct: 96 PGAFRRLRNLNTLLLNNNQIKRIPSGAFEDLENLKYLYLYKNE 138
>gi|3287742|sp|Q58692|BIOB_METJA BIOTIN SYNTHASE (BIOTIN SYNTHETASE) >gi|2127784|pir||G64461 biotin synthetase - Methanococcus jannaschii >gi|1591934 (U67570) biotin synthetase (bioB) [Methanococcus jannaschii] Length = 358 Score = 32.8 bits (73), Expect = 2.9 Identities = 30/94 (31%), Positives = 45/94 (46%) Query: 309 SLHDLIIYSDDVYLNELYNEISNNSTXLCSFTLYKFLKNYKKIKVTNLINEGIETGYNKL 130 SL + I + D +YL YN S +F + +KN KIK+ +IN ++G K Sbjct: 13 SLKNKIDFDDALYL---YNNFSAIDLLYLAFKIKNRIKNNSKIKLCAIIN--AKSGKCKE 67 Query: 129 PKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLK 28 IFC S + N+ +Y L S+ E L+ K Sbjct: 68 DCIFCSQS---IYSKCNIPIYPLKSKKEILEYAK 98
>gi|3252977 (AF068919) Ras-binding protein SUR-8 [Caenorhabditis elegans] >gi|3293318 (AF054827) leucine-rich repeat protein SOC-2 [Caenorhabditis elegans] Length = 559 Score = 32.8 bits (73), Expect = 2.9 Identities = 18/43 (41%), Positives = 27/43 (61%) Query: 132 LPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKNE 4 LP+ ++ NL+ L L N L KLP++ NL L+ L+L +NE Sbjct: 390 LPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENE 432
>gi|3845225 (AE001405) hypothetical protein [Plasmodium falciparum] Length = 166 Score = 32.5 bits (72), Expect = 3.8 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 4/92 (4%) Query: 306 LHDLIIYSDDVYLNELYNEISNNSTXLCSFTLYKFLKNYKKIKVTNLINEGIETGYNKLP 127 + D IY D +Y++E + N +F KNY K+ + + N+G E Y K+ Sbjct: 53 IRDKGIYGDFIYVDEYIVDDQNKK---------QFEKNYNKLNIHSFKNKGYE--YTKMF 101 Query: 126 KIF----CEISNLKHLTLMNLNLYKLPSRFENLKDL 31 K C +S L+ N N Y+ +N++ L Sbjct: 102 KAIKNENCPLSYLQLRLWRNKNCYEQYVNNKNIQTL 137
>gi|4092771 (AF105139) disease resistance gene homolog 1A [Brassica napus] Length = 927 Score = 32.5 bits (72), Expect = 3.8 Identities = 16/43 (37%), Positives = 23/43 (53%) Query: 147 TGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILN 19 +G KLP + NLK+L L + +LP F L +L+ LN Sbjct: 592 SGVTKLPDFLVTLFNLKYLNLSKTEVKELPRDFHRLINLETLN 634
>gi|3845236 (AE001407) T-complex protein 1 (HSP60 fold superfamily) [Plasmodium falciparum] Length = 540 Score = 32.5 bits (72), Expect = 3.8 Identities = 22/76 (28%), Positives = 42/76 (54%), Gaps = 6/76 (7%) Query: 243 NNSTXLCSFT------LYKFLKNYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLM 82 +N+ L ++T + K++ N+KK V +I G + + + FC+ +N+ L Sbjct: 257 HNAEELINYTKGEELQMKKYIDNFKKANVDVIIVNG---AISDIAQHFCDTNNIMTL--- 310 Query: 81 NLNLYKLPSRFENLKDLKILNL 16 K+ S+FE L+ K+LN+ Sbjct: 311 -----KITSKFETLRICKLLNI 327
>gi|1361985|pir||A57072 disease resistance protein RPM1 - Arabidopsis thaliana >gi|963017|emb|CAA61131| (X87851) disease resistance gene [Arabidopsis thaliana] Length = 926 Score = 32.5 bits (72), Expect = 3.8 Identities = 22/74 (29%), Positives = 37/74 (49%), Gaps = 2/74 (2%) Query: 240 NSTXLCSFTLYKF--LKNYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLY 67 +S +CS +K L + ++ +L + I +KLP + NLK+L L + Sbjct: 562 HSLLVCSSAKHKMELLPSLNLLRALDLEDSSI----SKLPDCLVTMFNLKYLNLSKTQVK 617 Query: 66 KLPSRFENLKDLKILN 19 +LP F L +L+ LN Sbjct: 618 ELPKNFHKLVNLETLN 633
>gi|3649772|emb|CAB11121| (Z98547) predicted using hexExon; MAL3P3.18 (PFC0425w), Hypothetical protein, len: 4551 aa [Plasmodium falciparum] Length = 4550 Score = 32.5 bits (72), Expect = 3.8 Identities = 24/92 (26%), Positives = 45/92 (48%) Query: 282 DDVYLNELYNEISNNSTXLCSFTLYKFLKNYKKIKVTNLINEGIETGYNKLPKIFCEISN 103 +D +N++ N +N++ Y FL Y+KI ++ I GI + I +I + Sbjct: 1329 NDKEMNDILNNKNNDTDK--KLNKYNFLMEYQKIISSDKITSGISNNMKDIKNI-KDIKD 1385 Query: 102 LKHLTLMNLNLYKLPSRFENLKDLKILNLVKN 7 +K + N+ K +++KD+K + VKN Sbjct: 1386 IK--DIKNIKDIKDIKDIKDIKDIKDIKNVKN 1415
>gi|3461839 (AC005315) putative receptor protein kinase [Arabidopsis thaliana] Length = 786 Score = 32.1 bits (71), Expect = 5.0 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Query: 186 KIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKL-PSRFENLKDLKILNLVK 10 KI NL G+ TG LP +F ++ ++ L L N +L L PS N+K L +L+L Sbjct: 309 KIISLNLSASGL-TG--SLPSVFQNLTQIQELDLSNNSLTGLVPSFLANIKSLSLLDLSG 365 Query: 9 NEF 1 N F Sbjct: 366 NNF 368
>gi|4455310|emb|CAB36845| (AL035528) putative disease resistance protein [Arabidopsis thaliana] Length = 741 Score = 32.1 bits (71), Expect = 5.0 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Query: 135 KLPKIFCEISNLKHLTLMNLNLY-KLPSRFENLKDLKILNLVKN 7 ++PK CE+ NL+ L L N N +P FENL L +L+L N Sbjct: 363 EIPKTICELDNLRILVLSNNNFSGSIPRCFENL-HLYVLHLRNN 405 Score = 31.3 bits (69), Expect = 8.6 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Query: 132 LPKIFCEISNLKHLTLMNLNLY-KLPSRFENLKDLKILNLVKNEF 1 LP + LK L L+N NL+ K+PS NL L L+L N+F Sbjct: 66 LPDSIGNLKRLKVLVLVNCNLFGKIPSSLGNLSYLTHLDLSYNDF 110
>gi|3649753|emb|CAB11102| (Z98547) predicted using hexExon; MAL3P3.2 (PFC0330w), PDZ domain protein, len: 700 aa [Plasmodium falciparum] Length = 699 Score = 32.1 bits (71), Expect = 5.0 Identities = 35/107 (32%), Positives = 55/107 (50%), Gaps = 12/107 (11%) Query: 345 CTNYKITSDDY----DSLHDLIIYSD------DVYLNELYNEISNNSTXLCSFTLYKFLK 196 C +Y + S + +L DLI +S+ D +++LY E NN + TL K L+ Sbjct: 338 CVSYNMKSHTFKRSISNLSDLIEFSNKLKYVLDERIHKLYYEDKNNENAYLNKTLRKELE 397 Query: 195 NYKKIK-VTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFE-NLKDLKI 25 KK + VTNL + ++ S+LK + N+YK +E L DLK+ Sbjct: 398 IGKKERDVTNLSKKNLQMSIE---------SSLKLIEKCMQNMYK--QNYEITLHDLKL 445
>gi|548879|sp|Q01730|RSU1_MOUSE RAS SUPPRESSOR PROTEIN 1 (RSU-1) (RSP-1 PROTEIN) (RSP-1) >gi|284990|pir||S25770 RSP-1 protein - mouse >gi|54015|emb|CAA44765| (X63039) p33 RSP-1 [Mus musculus] Length = 277 Score = 32.1 bits (71), Expect = 5.0 Identities = 21/61 (34%), Positives = 29/61 (47%) Query: 189 KKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVK 10 K ++V N N IE +LP + LKHL L L LP F + + L++L L Sbjct: 63 KNLEVLNFFNNQIE----ELPTQISSLQKLKHLNLGMNRLNTLPRGFGSSRLLEVLELTY 118 Query: 9 N 7 N Sbjct: 119 N 119
>gi|2213599 (AC000348) T7N9.19 [Arabidopsis thaliana] Length = 1556 Score = 31.7 bits (70), Expect = 6.6 Identities = 14/42 (33%), Positives = 25/42 (59%) Query: 135 KLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVK 10 +LPK F ++ +L L + + +LP F NL +L +L ++K Sbjct: 1164 RLPKSFGDLKSLHRLYMQETLVAELPESFGNLSNLMVLEMLK 1205
>gi|4049911 (AF063866) ORF MSV227 leucine rich repeat gene family protein, similar to Amsacta moorei entomopoxvirus Q3 ORF SW:P28854 [Melanoplus sanguinipes entomopoxvirus] Length = 306 Score = 31.7 bits (70), Expect = 6.6 Identities = 27/86 (31%), Positives = 49/86 (56%), Gaps = 5/86 (5%) Query: 270 LNEL-YNEISNNSTXLCSFTLYKFLKNYKKIKVTNLINEGIETGYNKLPKIFCEISNL-- 100 LN+L +N I NN L FT K L N K++ + ++I++ ++ N+ Sbjct: 99 LNKLEFNVIVNNE--LNDFTSLKILVNLKELHINSIIDK-------------LQLKNILL 143 Query: 99 -KHLTLMNLN-LYKLPSRFENLKDLKILNLV 13 K+L + N + +Y F+NL++LKIL+++ Sbjct: 144 PKNLEIFNTDAVYIKKDIFKNLENLKILSII 174
>gi|3894389 (AF053996) Hcr2-2A [Lycopersicon pimpinellifolium] Length = 802 Score = 31.7 bits (70), Expect = 6.6 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Query: 195 NYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLY-KLPSRFENLKDLKILN 19 N +K+ L ++ K+P+ IS L+ LT+ NL ++PS NL+ L+IL+ Sbjct: 357 NLTSLKILYLRRNNLK---GKVPQCLGNISGLQVLTMSPNNLSGEIPSSISNLRSLQILD 413 Query: 18 LVKN 7 L +N Sbjct: 414 LGRN 417
>gi|3845160 (AE001388) SERA antigen/papain-like protease with active Ser [Plasmodium falciparum] Length = 930 Score = 31.7 bits (70), Expect = 6.6 Identities = 18/61 (29%), Positives = 30/61 (48%) Query: 204 FLKNYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKI 25 FLK+YK +KVT N + +P IF + ++ +++ KL R + KD + Sbjct: 118 FLKHYKGVKVTGSCNANFQLFL--VPHIFINVETKENNIQLDVKFLKLTKRIDFAKDKSM 175 Query: 24 L 22 L Sbjct: 176 L 176
>gi|3377849 (AF076274) similar to receptor protein kinases [Arabidopsis thaliana] Length = 766 Score = 31.7 bits (70), Expect = 6.6 Identities = 23/67 (34%), Positives = 40/67 (59%), Gaps = 4/67 (5%) Query: 207 KFLKNYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKL----PSRFENL 40 K LKN +++ +++E + G +P +I NL +L+ ++L++ KL PS NL Sbjct: 175 KELKNLQEL----ILDENLIGG--AIPSEIDDIGNLVNLSTLSLSMNKLSGGIPSSIHNL 228 Query: 39 KDLKILNLVKN 7 K+L+ L L N Sbjct: 229 KNLETLQLENN 239
>gi|2781362 (AC003113) F24O1.18 [Arabidopsis thaliana] Length = 786 Score = 31.3 bits (69), Expect = 8.6 Identities = 19/55 (34%), Positives = 33/55 (59%), Gaps = 4/55 (7%) Query: 165 INEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKL----PSRFENLKDLKILNLVKNEF 1 +NE I + N + +I NLK++T+ +++ +L PS N+K L+ LN+ N F Sbjct: 246 LNEIILSNDNLTGCLPPQIGNLKNVTVFDISFNRLSGPLPSSIGNMKSLEQLNVANNRF 304
>gi|3875045|emb|CAA99797| (Z75530) C47E8.2 [Caenorhabditis elegans] >gi|3875244|emb|CAA99813| (Z75532) C47E8.2 [Caenorhabditis elegans] Length = 411 Score = 31.3 bits (69), Expect = 8.6 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 4/89 (4%) Query: 339 NYKITSDDYDS----LHDLIIYSDDVYLNELYNEISNNSTXLCSFTLYKFLKNYKKIKVT 172 NY D Y+ L+ L I+S YL E+ + S N+ + F KFL+ K Sbjct: 321 NYNYRKDVYEKTQTQLNILFIFSVFKYLIEIKSAFSKNTGFI--FFFEKFLEELFSRKKN 378 Query: 171 NLINEGIETGYNKLPKIFCEISNLKHLTLMNLN 73 E+ N+ IFC N++H N N Sbjct: 379 -------ESNKNQKCSIFCFFENIRHSIWKNFN 404
>gi|1345878|sp|P49606|CYAA_USTMA ADENYLATE CYCLASE (ATP PYROPHOSPHATE-LYASE) (ADENYLYL CYCLASE) >gi|1078670|pir||A55481 adenylate cyclase (EC 4.6.1.1) uac1 - smut fungus (Ustilago maydis) >gi|603940 (L33918) uac1 [Ustilago maydis] Length = 2493 Score = 31.3 bits (69), Expect = 8.6 Identities = 18/72 (25%), Positives = 35/72 (48%) Query: 219 FTLYKFLKNYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYKLPSRFENL 40 F L + + ++ N+ N E + PK+ C++ +L L + ++ +LP+ NL Sbjct: 1193 FDLPSYFSSISTLRNLNISNNRFE----EFPKVICDVPSLVDLDVSFNSITELPAEIANL 1248 Query: 39 KDLKILNLVKNE 4 +L+ L NE Sbjct: 1249 INLERFILAGNE 1260
>gi|1350783|sp|P47735|RLK5_ARATH RECEPTOR-LIKE PROTEIN KINASE 5 PRECURSOR >gi|282883|pir||S27756 receptor-like protein kinase precursor - Arabidopsis thaliana >gi|166850 (M84660) receptor-like protein kinase [Arabidopsis thaliana] >gi|2842492|emb|CAA16889| (AL021749) receptor-like protein kinase 5 precursor (RLK5) [Arabidopsis thaliana] Length = 999 Score = 31.3 bits (69), Expect = 8.6 Identities = 30/106 (28%), Positives = 59/106 (55%), Gaps = 17/106 (16%) Query: 339 NYKITSDDYDSLHDLII--YSDDVYLNEL------------YNEISNNSTXLCSFTLYKF 202 N +++DD+D+ H+LI S+++ + + + EIS N+ S T+ Sbjct: 102 NGSLSADDFDTCHNLISLDLSENLLVGSIPKSLPFNLPNLKFLEISGNN---LSDTIPSS 158 Query: 201 LKNYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLY---KLPSRFENLKDL 31 ++K++ NL + +P ++ LK L L NL+ ++PS+ NL +L Sbjct: 159 FGEFRKLESLNLAGNFLS---GTIPASLGNVTTLKELKLA-YNLFSPSQIPSQLGNLTEL 214 Query: 30 KIL 22 ++L Sbjct: 215 QVL 217
>gi|4115383 (AC005967) receptor-like protein kinase [Arabidopsis thaliana] Length = 809 Score = 31.3 bits (69), Expect = 8.6 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 5/94 (5%) Query: 285 SDDVYLNELYNEISNNSTXLCSFTL-----YKFLKNYKKIKVTNLINEGIETGYNKLPKI 121 +D +++E Y ++ +S+ +F+ + K V LI G+ Sbjct: 28 TDGFFVSEFYKQMGLSSSQAYNFSAPFCSWQGLFCDSKNEHVIMLIASGMSLSGQIPDNT 87 Query: 120 FCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKNE 4 ++S L+ L L N + LPS F +L LK LNL N+ Sbjct: 88 IGKLSKLQSLDLSNNKISALPSDFWSLNTLKNLNLSFNK 126
>gi|1469876|dbj|BAA09768| (D63481) The KIAA0147 gene product is related to adenylyl cyclase. [Homo sapiens] Length = 1551 Score = 31.3 bits (69), Expect = 8.6 Identities = 16/44 (36%), Positives = 26/44 (58%) Query: 138 NKLPKIFCEISNLKHLTLMNLNLYKLPSRFENLKDLKILNLVKN 7 ++LP F ++ +L HL L +++L LP NL +L L L +N Sbjct: 52 SRLPDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELREN 95
>gi|3894385 (AF053994) Hcr2-0A [Lycopersicon esculentum] Length = 826 Score = 31.3 bits (69), Expect = 8.6 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Query: 195 NYKKIKVTNLINEGIETGYNKLPKIFCEISNLKHLTLMNLNLYK-LPSRFENLKDLKILN 19 N +K+ L ++ K+P+ IS L+ LT+ NL +PS NL+ L+IL+ Sbjct: 381 NLTSLKILYLRRNNLK---GKVPQCLGNISGLQVLTMSRNNLSGVIPSSISNLRSLQILD 437 Query: 18 LVKN 7 L +N Sbjct: 438 LGRN 441 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 12, 1999 12:54 PM Number of letters in database: 112,640,273 Number of sequences in database: 368,476 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 109257924 Number of Sequences: 368476 Number of extensions: 1704290 Number of successful extensions: 4383 Number of sequences better than 10.0: 88 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 27 Number of HSP's that attempted gapping in prelim test: 4323 Number of HSP's gapped (non-prelim): 95 length of query: 275 length of database: 112640273 effective HSP length: 54 effective length of query: 220 effective length of database: 92742569 effective search space: 20403365180 effective search space used: 20403365180 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 69 (31.3 bits)