BLASTX 2.0.8 [Jan-05-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 11VII-18F (326 letters) Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR 368,476 sequences; 112,640,273 total letters Searching...................................................done Score E Sequences producing significant alignments: (bits) Value gi|2498886|sp|Q15437|S23B_HUMAN PROTEIN TRANSPORT PROTEIN SEC23 ... 53 5e-07 gi|2137751|pir||I60247 SEC23 protein homolog, 64.7K - mouse >gi|... 52 1e-06 gi|2498884|sp|Q01405|S23A_MOUSE PROTEIN TRANSPORT PROTEIN SEC23 ... 52 1e-06 gi|2498885|sp|Q15436|S23A_HUMAN PROTEIN TRANSPORT PROTEIN SEC23 ... 52 1e-06 gi|3702631|emb|CAA21224| (AL031824) protein transport protein se... 31 4.0 gi|3786491 (AF098993) No definition line found [Caenorhabditis e... 30 5.2 gi|3878421|emb|CAB01883| (Z79601) predicted using Genefinder; si... 29 8.9 gi|134277|sp|P15303|SC23_YEAST PROTEIN TRANSPORT PROTEIN SEC23 >... 29 8.9
>gi|2498886|sp|Q15437|S23B_HUMAN PROTEIN TRANSPORT PROTEIN SEC23 HOMOLOG ISOFORM B >gi|1296666|emb|CAA65775| (X97065) Sec23 protein [Homo sapiens] Length = 767 Score = 53.5 bits (126), Expect = 5e-07 Identities = 21/25 (84%), Positives = 24/25 (96%) Query: 250 MATYQDFIQQNEDRDGVRFSWNLWP 324 MATY +FIQQNE+RDGVRFSWN+WP Sbjct: 1 MATYLEFIQQNEERDGVRFSWNVWP 25
>gi|2137751|pir||I60247 SEC23 protein homolog, 64.7K - mouse >gi|220494|dbj|BAA02209| (D12713) MSEC66 [Mus musculus] Length = 573 Score = 51.9 bits (122), Expect = 1e-06 Identities = 20/25 (80%), Positives = 23/25 (92%) Query: 250 MATYQDFIQQNEDRDGVRFSWNLWP 324 M TY +FIQQNE+RDGVRFSWN+WP Sbjct: 1 MTTYLEFIQQNEERDGVRFSWNVWP 25
>gi|2498884|sp|Q01405|S23A_MOUSE PROTEIN TRANSPORT PROTEIN SEC23 HOMOLOG ISOFORM A Length = 623 Score = 51.9 bits (122), Expect = 1e-06 Identities = 20/25 (80%), Positives = 23/25 (92%) Query: 250 MATYQDFIQQNEDRDGVRFSWNLWP 324 M TY +FIQQNE+RDGVRFSWN+WP Sbjct: 1 MTTYLEFIQQNEERDGVRFSWNVWP 25
>gi|2498885|sp|Q15436|S23A_HUMAN PROTEIN TRANSPORT PROTEIN SEC23 HOMOLOG ISOFORM A >gi|1296664|emb|CAA65774| (X97064) Sec23 protein [Homo sapiens] Length = 765 Score = 51.9 bits (122), Expect = 1e-06 Identities = 20/25 (80%), Positives = 23/25 (92%) Query: 250 MATYQDFIQQNEDRDGVRFSWNLWP 324 M TY +FIQQNE+RDGVRFSWN+WP Sbjct: 1 MTTYLEFIQQNEERDGVRFSWNVWP 25
>gi|3702631|emb|CAA21224| (AL031824) protein transport protein sec23 homolog [Schizosaccharomyces pombe] Length = 759 Score = 30.5 bits (67), Expect = 4.0 Identities = 10/17 (58%), Positives = 16/17 (93%) Query: 274 QQNEDRDGVRFSWNLWP 324 ++ E+RDGVRF+WN++P Sbjct: 4 EEIEERDGVRFTWNVFP 20
>gi|3786491 (AF098993) No definition line found [Caenorhabditis elegans] Length = 421 Score = 30.1 bits (66), Expect = 5.2 Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 50 WRIVRHWFKYLRLILEWEGEEYLYNKQFTTTSEKNYHIDTTXATYPVLLDLRTL 211 WRIV + + + +EWE +Y ++ TT SE I + +P+ +++R L Sbjct: 277 WRIVIITIRTVSITIEWEMSRQVYIEKLTTNSEN--LISASYDHHPIPVNVRRL 328
>gi|3878421|emb|CAB01883| (Z79601) predicted using Genefinder; similar to serine/threonine kinase; cDNA EST EMBL:C11835 comes from this gene; cDNA EST EMBL:C10260 comes from this gene; cDNA EST yk409b3.3 comes from this gene; cDNA EST yk409b3.5 comes fr... Length = 693 Score = 29.3 bits (64), Expect = 8.9 Identities = 18/50 (36%), Positives = 29/50 (58%) Query: 74 KYLRLILEWEGEEYLYNKQFTTTSEKNYHIDTTXATYPVLLDLRTLTLVY 223 +YLRLI E E EE +KQF+ TS H++ A + V ++ + ++Y Sbjct: 212 EYLRLIQELEEEEK--SKQFSATSSSAPHVNPYSAQHLVNGEIIGIFVIY 259
>gi|134277|sp|P15303|SC23_YEAST PROTEIN TRANSPORT PROTEIN SEC23 >gi|73083|pir||BVBY23 protein transport protein SEC23 - yeast (Saccharomyces cerevisiae) >gi|4443|emb|CAA33501| (X15474) SEC23 gene product (AA 1 - 768) [Saccharomyces cerevisiae] >gi|786326 (U25842) Protein transport protein Sec23p (Swiss Prot. accession number P15303) [Saccharomyces cerevisiae] Length = 768 Score = 29.3 bits (64), Expect = 8.9 Identities = 10/17 (58%), Positives = 15/17 (87%) Query: 274 QQNEDRDGVRFSWNLWP 324 + NED +GVRF+WN++P Sbjct: 4 ETNEDINGVRFTWNVFP 20 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 12, 1999 12:54 PM Number of letters in database: 112,640,273 Number of sequences in database: 368,476 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66382891 Number of Sequences: 368476 Number of extensions: 1166892 Number of successful extensions: 2252 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 2246 Number of HSP's gapped (non-prelim): 8 length of query: 108 length of database: 112640273 effective HSP length: 50 effective length of query: 58 effective length of database: 94216473 effective search space: 5464555434 effective search space used: 5464555434 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 64 (29.3 bits)