BLASTX 2.0.8 [Jan-05-1999]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 11VII-28F
         (488 letters)

Database: Non-redundant GenBank CDS
translations+PDB+SwissProt+SPupdate+PIR
           368,476 sequences; 112,640,273 total letters

Searching...................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gi|2493012|sp|Q12697|ATC9_YEAST PROBABLE CALCIUM-TRANSPORTING AT...    32  1.9
gi|133591|sp|P18458|RRPB_BEV RNA-DIRECTED RNA POLYMERASE (ORF1B)...    32  2.5


>gi|2493012|sp|Q12697|ATC9_YEAST PROBABLE CALCIUM-TRANSPORTING ATPASE 9 >gi|2132937|pir||S67195 probable membrane protein YOR291w - yeast (Saccharomyces cerevisiae) >gi|1420646|emb|CAA99518| (Z75199) ORF YOR291w [Saccharomyces cerevisiae] Length = 1472 Score = 32.5 bits (72), Expect = 1.9 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Query: 160 ECNNTYTF--DIFTMLGIKISILPNEFMNYFILNNHSYLEIEIDDKTEIV 17 ECN T D+F +L + +P E++N +LN+ Y + D+K E++ Sbjct: 1123 ECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELM 1172
>gi|133591|sp|P18458|RRPB_BEV RNA-DIRECTED RNA POLYMERASE (ORF1B) >gi|94017|pir||S11238 polymerase - Berne virus >gi|1334814|emb|CAA36601| (X52374) 2nd polymerase reading frame (AA 1-2291) [Berne virus] Length = 2291 Score = 32.1 bits (71), Expect = 2.5 Identities = 16/32 (50%), Positives = 18/32 (56%) Query: 378 NILSTPKGYGNLFKIFPNYKVFITGYKSFYSG 473 NILS Y N I PN+KVF T + YSG Sbjct: 2227 NILSRIAAYRNKLCIVPNFKVFSTSFSYKYSG 2258 Database: Non-redundant GenBank CDS translations+PDB+SwissProt+SPupdate+PIR Posted date: Apr 12, 1999 12:54 PM Number of letters in database: 112,640,273 Number of sequences in database: 368,476 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.270 0.0470 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75645462 Number of Sequences: 368476 Number of extensions: 1394378 Number of successful extensions: 3730 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3729 Number of HSP's gapped (non-prelim): 2 length of query: 162 length of database: 112640273 effective HSP length: 52 effective length of query: 110 effective length of database: 93479521 effective search space: 10282747310 effective search space used: 10282747310 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 66 (30.1 bits)